Project

General

Profile

p

2 bounced messages, in full - robin_listas, 2022-08-11 16:34

 
1
From MAILER-DAEMON Thu Aug 11 18:34:06 2022
2
Date: 11 Aug 2022 18:34:06 +0200
3
From: Mail System Internal Data <MAILER-DAEMON@Telcontar.valinor>
4
Subject: DON'T DELETE THIS MESSAGE -- FOLDER INTERNAL DATA
5
Message-ID: <1660235646@Telcontar.valinor>
6
X-IMAP: 1660235646 0000000003 NonJunk
7
Status: RO
8

    
9
This text is part of the internal format of your mail folder, and is not
10
a real message.  It is created automatically by the mail system software.
11
If deleted, important folder data will be lost, and it will be re-created
12
with the data reset to initial values.
13

    
14
From cer@Telcontar.valinor Thu Aug 11 18:28:43 2022 +0200
15
Return-Path: <>
16
Delivered-To: robin.listas@telefonica.net
17
Received: from dovector01.e.movistar.es ([217.116.1.119])
18
	by lda06.e.movistar.es (Dovecot) with LMTP id 8zrvDTsu9WLQDwAAdnA+5w
19
	for <robin.listas@telefonica.net>; Thu, 11 Aug 2022 18:28:43 +0200
20
Received: from asavin05.e.movistar.es ([217.116.1.119])
21
	by dovector01.e.movistar.es with LMTP
22
	id 8KFMDTsu9WICdAUAPBbRZA
23
	(envelope-from <>)
24
	for <robin.listas@telefonica.net>; Thu, 11 Aug 2022 18:28:43 +0200
25
Received: from relayin04.e.movistar.es (217-116-1-119.redes.acens.net [217.116.1.119])
26
	by asavin05.e.movistar.es (Postfix) with ESMTP id 4M3XLL6g8bzWk3p
27
	for <robin.listas@telefonica.net>; Thu, 11 Aug 2022 18:28:42 +0200 (CEST)
28
X-Tnet-ASAV: Yes
29
Received: from EUR04-DB3-obe.outbound.protection.outlook.com (mail-oln040092074109.outbound.protection.outlook.com [40.92.74.109])
30
	(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
31
	(No client certificate requested)
32
	by relayin04.e.movistar.es (Postfix) with ESMTPS id 4M3XLL4wNkzXdnB
33
	for <robin.listas@telefonica.net>; Thu, 11 Aug 2022 18:28:41 +0200 (CEST)
34
ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none;
35
 b=G1nVW96sIlbllWsksdBF7bPkO5+3IRFtXW8Ha2GQbJy07lrZcuZWVNb91TxNjD/AXnwX6p9Oan8yWtU9SX+IWikrhELs0yYWO5uqZQiMSUGCoc5V0o4GJcHo77uViRIHZmX+SLWhUDGWdDyyhu8Cq8dIYegtBjnepOS7KkirZc3hrX4VH3phy26wFomkPLgeAHrvNXhstMFqPIQkzMPUPM5eQFa3CzQTOprFYl6osBiDlj6Rqq2Yr+G32RxkpPscqadw0gZiek+wtgnhvxkeYpLtIIcPoq6EBPb06zTWhc5eChl2xuSLLApArxCLPdRJQGBOtNTLKdyU0zLeXyYHbA==
36
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com;
37
 s=arcselector9901;
38
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1;
39
 bh=ajHMQqNobqtbwi6zEtedZTfPs7yOfybJusM/5zuN/v0=;
40
 b=DV/dMyxcPedPHJbgAb5r9Dm7o2+pjyHXuwRHwAP+TgCgyiho+Uhlak9EgqFK19PynOdqQ5VtIzTOE8l4pFh42PA9QFkoYtRKND7IQziN75iIBO5HQfnJbhpmtBd4frYKBUp0WoAawsF45krNqw20IClXEuX/eWa8r4/zqGbmbOsDUji4prm3zVqcRf4qh1smjgmlTrmr6GagRp4ELdRBZcIXHtSJcl/abMvxaYOITdivIADQdopz/yq2PbuxAMK34oNA5usd/1LWCP2VnhsBxE5FhuatABWylMG8eld0QI3Q3iaqYbMCS53d2Uu34A9hc6GSwi5/j3b9bJCnmmSaRA==
41
ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none;
42
 dkim=none; arc=none
43
MIME-Version: 1.0
44
From: <postmaster@outlook.com>
45
To: <robin.listas@telefonica.net>
46
Date: Thu, 11 Aug 2022 16:28:40 +0000
47
Content-Type: multipart/report; report-type=delivery-status;
48
	boundary="58819725-0049-4b88-9e9a-811e69eafffe"
49
X-MS-Exchange-Message-Is-Ndr:
50
Content-Language: en-CA
51
Message-ID:
52
 <65cc265b-1835-4c71-b15c-6369473edab3@GV1PR01MB8849.eurprd01.prod.exchangelabs.com>
53
In-Reply-To: <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
54
References: <ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net>
55
 <fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com>
56
 <95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net>
57
 <20220811112640.yothu2esdyy264nx@grusum.dhaller.de>
58
 <9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net>
59
 <20220811132813.GQ22216@wahoo.no-ip.org>
60
 <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
61
 <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
62
Subject: Undeliverable: Re: [oS-en] Recovering dead text file
63
Auto-Submitted: auto-replied
64
X-MS-PublicTrafficType: Email
65
X-MS-TrafficTypeDiagnostic: GV1PR01MB8849:EE_
66
X-Microsoft-Antispam: BCL:0;
67
X-Microsoft-Antispam-Message-Info:
68
	K6H/F2WdogZxr6/mgBtEH/g592lv3W08sl7euJlJnSUiKJiySXNrp5yn1C4upkvpB4/NIxunnGPP39iAmtMT6blifb3vE8W9KYbyA2VWl72nYO36LIwgrDlAnxqHv8aSKL2fAbIcNzL4ehhw9qs9PfObtw4+qPT2JRQ3WLW9BzqM5rk2P5f6rdfECcMG+6A3j5i0RWOIxehw6HshdjvIAe/4l4QQOC4azxmziNNnjgsSXBBF/ZH9l/7omhbU89jCcDOe2s+6P1QhYk7e3ZBE6Wm34OeYvRQ2/+QvKo/7j/KcMdssXaNNx1hB9ZWSItDpudle6TrmUA7JweB/7jDjia2xbB+pX1JpBZcqgbxYhiZ6hBZwtg/XH8XWW3HAejfx3Be10TUP96Mn9hhC4GQL7UAtnqQwm423djEZzY07y/AXopSbtmV2SgGONOR+4O0LFc26X8N+rrUKaP+z7MIRL/PJ3/7bJYpmlVP+DpNJneq9bjGCuun5Sq71xE+siZ+4e9riF1YaRxHARwWzMqGld00IoMTNoCBS3O920ilJZ9T2qmwX+EWDEteJMgS+Ps1dOn5IuHia7G8OxlodAKFvqlc7grw6wmEjafrXEQHp10T45/1vP0uK9kv0NIccgX23OEQGaPW/qYAtPxN5ODRlZZLXFLAzqaWHRAWftTJ4as4D1afd9R7ZM8/Qp7OL+7hwMn14b2OHpqdzgwuI/B+cYDEqYe6hKhHZSDuYq9CXAsU=
69
X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1
70
X-MS-Exchange-AntiSpam-MessageData-0:
71
	ZEBP1v2LsjcXwxOgxuQNoNO6txQN25bslb3XxP2XNFVX01n4qbk5uuWzYGaJ9d+UZi18NWfdaAN6nrK1EQFe6fVE+QI99nnrSVxHvJ3tyO3x1lNQMULXFkfDbEEz+JhBM5PD4eKqkWx/AHrsxtJePB6u6keKzeopipq8KD7Yvw6fm80eYLgBtkTvRucIXHyN
72
X-OriginatorOrg: outlook.com
73
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 11 Aug 2022 16:28:40.5775
74
 (UTC)
75
X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted
76
X-MS-Exchange-CrossTenant-AuthSource:
77
	GV1PR01MB8849.eurprd01.prod.exchangelabs.com
78
X-MS-Exchange-CrossTenant-AuthAs: Internal
79
X-MS-Exchange-CrossTenant-Network-Message-Id:
80
	5bce39ce-4508-4ec9-8d4d-08da7bb68cf9
81
X-MS-Exchange-Transport-CrossTenantHeadersStamped: GV1PR01MB8849
82
X-TnetIn-SenderInfo: IP: 40.92.74.109 | Country: IE | SPF: pass
83
X-VADETIN-SPAMSTATE: bounce
84
X-VADETIN-SPAMSCORE: 10000
85
X-VADETIN-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrvdeggedguddtudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucetvefgpffuqdeuvdevnecuuegrihhlohhuthemuceftddtnecupfhothhifhhitggrthhiohhnucdluddttddttddmnecujfgurhepggfhvffftgfkjghfufesphdtreertddtvdenucfhrhhomhepoehpohhsthhmrghsthgvrhesohhuthhlohhokhdrtghomheqnecuggftrfgrthhtvghrnhepgefgtddtgfeukeekieehtdekvdevtdethfelveeuuefftdettdefffefkeehtdegnecuffhomhgrihhnpegvuhhrphhrugdtuddrphhrohgupdhgohhoghhlvgdrtghomhdpohhuthhlohhokhdrtghomhdpudgvuddttddrnhgvthdpohhpvghnshhushgvrdhorhhgpdgvohhpqdgvuhhrtdeirdhprhhougenucfkphepgedtrdelvddrjeegrddutdelnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepgedtrdelvddrjeegrddutdelpdhhvghlohepgfgftfdtgedqffeufedqohgsvgdrohhuthgsohhunhgurdhprhhothgvtghtihhonhdrohhuthhlohhokhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehrohgsihhnrdhlihhsthgrshesthgvlhgvfhhonhhitggrrdhnvght
86
X-TnetIn-Information: AntiSPAM and AntiVIRUS on asavin05
87
X-TnetIn-MsgID: 4M3XLL6g8bzWk3p.A2854
88
X-TnetIn-SpamCheck: no es spam, bounce DKIM_NONE SPF_PASS
89
X-TnetIn-From: 
90
X-Spam-Status: No
91
Status: R
92
X-Status: 
93
X-Keywords: NonJunk          
94
X-UID: 2
95

    
96
--58819725-0049-4b88-9e9a-811e69eafffe
97
Content-Type: multipart/alternative; differences=Content-Type;
98
	boundary="fa0b0883-f1a9-4970-993f-080a23243e7c"
99

    
100
--fa0b0883-f1a9-4970-993f-080a23243e7c
101
Content-Type: text/plain; charset="us-ascii"
102
Content-Transfer-Encoding: quoted-printable
103

    
104
Delivery has failed to these recipients or groups:
105

    
106
amdlnx60@googlemail.com<mailto:amdlnx60@googlemail.com>
107
Your message wasn't delivered because the recipient's email provider reject=
108
ed it.
109

    
110

    
111

    
112

    
113

    
114

    
115

    
116

    
117
Diagnostic information for administrators:
118

    
119
Generating server: GV1PR01MB8849.eurprd01.prod.exchangelabs.com
120

    
121
amdlnx60@googlemail.com
122
Remote Server returned '550-5.7.26 The MAIL FROM domain [telefonica.net] ha=
123
s an SPF record with a hard 550-5.7.26 fail policy (-all) but it fails to p=
124
ass SPF checks with the ip: 550-5.7.26 [104.47.12.57]. To best protect our =
125
users from spam and phishing, 550-5.7.26 the message has been blocked. Plea=
126
se visit 550-5.7.26 https://support.google.com/mail/answer/81126#authentica=
127
tion for more 550 5.7.26 information. ec2-20020a170906b6c200b007306f2ffcc7s=
128
i7119039ejb.345 - gsmtp'
129

    
130
Original message headers:
131

    
132
Received: from GV1PR01MB8580.eurprd01.prod.exchangelabs.com
133
 (2603:10a6:150:27::8) by GV1PR01MB8849.eurprd01.prod.exchangelabs.com
134
 (2603:10a6:150:2c::7) with Microsoft SMTP Server (version=3DTLS1_2,
135
 cipher=3DTLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.5504.14; Thu, 11 =
136
Aug
137
 2022 16:28:39 +0000
138
Resent-From: <gregormeier@outlook.com>
139
Received: from GV1PR01MB8580.eurprd01.prod.exchangelabs.com ([::1]) by
140
 GV1PR01MB8580.eurprd01.prod.exchangelabs.com ([fe80::7829:c80b:e85c:ace1%5=
141
])
142
 with Microsoft SMTP Server id 15.20.5504.021; Thu, 11 Aug 2022 16:28:39 +0=
143
000
144
ARC-Seal: i=3D2; a=3Drsa-sha256; s=3Darcselector9901; d=3Dmicrosoft.com; cv=
145
=3Dpass;
146
 b=3DMPlTu4giO1c33bMpZnoxxaZs9D52gLrgfqYcG4xOaR56TyIph+BPY8nWE4LgdVUWqkavAj=
147
/d4WKF1nGekX7Au88lvWlzQMl+o5j6RLmC5UCVe0M3KS19Kv0AGnBWlH4eO9PfNlS+fDTxeFkLd=
148
wi5KQnS7bQfYODSVnJ6LvFKHI6bnCLubR0Vjo2O3MIfgKubGjDH4WuB1oUVFwUcGIW/SMOTX5S6=
149
t8uBWBtIclOZ/8rURm/jCKadtQz7+4DpbvVOK5NnLQvjOPwd/drmhwrbC6qEBRwmdF9ZHsC8Fhh=
150
Pfnhnknz2knAdxgJ1HD9DsnTVOvQXaS6mUwstAEPsLJTO0w=3D=3D
151
ARC-Message-Signature: i=3D2; a=3Drsa-sha256; c=3Drelaxed/relaxed; d=3Dmicr=
152
osoft.com;
153
 s=3Darcselector9901;
154
 h=3DFrom:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-A=
155
ntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Ex=
156
change-AntiSpam-MessageData-1;
157
 bh=3DNwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=3D;
158
 b=3DXOFCCwSqnpV8fwPrefGzdp70qoHBbadEDC2OaqFwur2G/CpLOmc02Rwof43GfO55KVYlk/=
159
3cTHcYnb8zeUPJTsnm/uh+ybCLZtOXvnCQ2Mu0DMViJonoZPHmjQ47SeKodRLmbL4F/1Vx7T+gx=
160
3YFW7ZhAX8MG/1GHQ6Hy4Cv8gXPnStdrUTskj29aUPEygMsuNqozO/MyqJfqvqPHsDzmTIlzrij=
161
yTZR6Ubfw9ddtFAX5fluJvq+hokrv0RHvzh+t2JRm2UVTaOW+yzHYZDE1/pO0acKCNv9NvhJNHm=
162
dpzla02m6/xQxNSsX6vEyBllQGDu/ocNnrMti0VPJKIT73w=3D=3D
163
ARC-Authentication-Results: i=3D2; mx.microsoft.com 1; spf=3Dpass (sender i=
164
p is
165
 209.85.222.41) smtp.rcpttodomain=3Doutlook.com smtp.mailfrom=3Dgmail.com;
166
 dmarc=3Dfail (p=3Dnone sp=3Dnone pct=3D100) action=3Dnone header.from=3Dte=
167
lefonica.net;
168
 dkim=3Dnone (message not signed); arc=3Dpass (0 oda=3D0 ltdi=3D1)
169
Authentication-Results: spf=3Dpass (sender IP is 209.85.222.41)
170
 smtp.mailfrom=3Dgmail.com; dkim=3Dnone (message not signed)
171
 header.d=3Dnone;dmarc=3Dfail action=3Dnone header.from=3Dtelefonica.net;
172
Received-SPF: Pass (protection.outlook.com: domain of gmail.com designates
173
 209.85.222.41 as permitted sender) receiver=3Dprotection.outlook.com;
174
 client-ip=3D209.85.222.41; helo=3Dmail-ua1-f41.google.com; pr=3DC
175
X-IncomingTopHeaderMarker: OriginalChecksum:230E059A3302EEAC1D99788EFB7844E=
176
16974B3DB7D6F73130699072111760613;UpperCasedChecksum:444DDBADA0FEBAE8561634=
177
24CBCBFD54AA4440F33169EEFE09FF0E1F351A144F;SizeAsReceived:9590;Count:64
178
X-Google-DKIM-Signature: v=3D1; a=3Drsa-sha256; c=3Drelaxed/relaxed;
179
        d=3D1e100.net; s=3D20210112;
180
        h=3Dlist-unsubscribe:list-subscribe:list-post:list-owner:list-help
181
         :list-archive:archived-at:list-id:precedence:message-id-hash
182
         :in-reply-to:from:references:to:content-language:subject:user-agen=
183
t
184
         :mime-version:date:message-id:delivered-to:x-gm-message-state
185
         :x-original-authentication-results:from:to:cc;
186
        bh=3DNwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=3D;
187
        b=3DzeenLGI/nnJNzTJESMWYGs9D8iZK7rgTswIdha8Ox0Q4c8FTQHOn38PqZNSgkkn=
188
c4V
189
         ClZhJXt7ogkLp6yDOY4dQf+WQMxHN5sSNxSjurn3UQTHECYo24+sGfTgDhlRy04FQo=
190
sL
191
         XEPoQX/eaTeImeWRiM8/r3kZbFv9fC1DJGinOhL0eNPBmKLP6ArxQAdYcY9a8j/YsK=
192
fS
193
         eTikz0ggS6QbNNn9X4k8V69DycbatHRD7YGLNc2ik7/mXfCfzvHr7+OmTsomSNo5r3=
194
8a
195
         PKUoTQbkrKt+yOg8FpE++niEQh8lnToppmknL63Z2LfhbH2Wk1UWedUVHjL1ICdo5e=
196
xE
197
         qE9Q=3D=3D
198
X-Original-Authentication-Results: mx.google.com;       spf=3Dpass (google.=
199
com: domain of users-bounces@lists.opensuse.org designates 2001:67c:2178:8:=
200
:18 as permitted sender) smtp.mailfrom=3Dusers-bounces@lists.opensuse.org; =
201
      dmarc=3Dfail (p=3DNONE sp=3DNONE dis=3DNONE) header.from=3Dtelefonica=
202
.net
203
X-Gm-Message-State: ACgBeo3UXhHA789Eiukny8y5hY2nYEGmwVn72dvCuREh3SP4xKQm+LM=
204
D
205
        FFXKRSJYk0Hhfv6Un+/L02Wy7lnceYl4DwqWRh64l16xfj5JqWnTsw=3D=3D
206
X-Received: by 2002:ab0:49a9:0:b0:387:71ed:915c with SMTP id e38-20020ab049=
207
a9000000b0038771ed915cmr14652232uad.85.1660235317432;
208
        Thu, 11 Aug 2022 09:28:37 -0700 (PDT)
209
X-Forwarded-To: gregormeier@outlook.com
210
X-Forwarded-For: amdlnx60@gmail.com gregormeier@outlook.com
211
Delivered-To: amdlnx60@gmail.com
212
X-Google-Smtp-Source: AA6agR7ZBSkOaMAd0M+mIS/pjCsF9OO2/lY0Sy4S1ify8OWIqI/rd=
213
YYuBL8sXMlwXY4FiyVnTpLX
214
X-Received: by 2002:a05:600c:322a:b0:3a5:3dda:10b3 with SMTP id r42-20020a0=
215
5600c322a00b003a53dda10b3mr6129532wmp.125.1660235315919;
216
        Thu, 11 Aug 2022 09:28:35 -0700 (PDT)
217
ARC-Seal: i=3D1; a=3Drsa-sha256; t=3D1660235315; cv=3Dnone;
218
        d=3Dgoogle.com; s=3Darc-20160816;
219
        b=3DZHM/k3moYKdnUJ0VE2+atgZHuhc71IbmKWugXVDq2BtYqORI6+EfqVr59tzJ2UV=
220
M0d
221
         y7RRWegmewn9zNyzUeeYt3Dnb2fFr31cK2jpSTOCPSLwkcAclVyfOCGxyAOFcurSSS=
222
cP
223
         B6qnhLP/sKLmVzFj18uDR6GwbyJF5oLtqLe8TlHFjD07+1mWG7gP9SFX2w/AQTm/Ib=
224
Ck
225
         qfSg5XH2e4qWb9cHuIiihOmGo2OGSDL6bnssMFYNJriIpfI9uYmPLRhJ5pFV0jnhQA=
226
B+
227
         IlK4SxKlwF6dCKJhigXrnjjKW/tZGU2wQ+pTfP5PJhrSwlZV2apTRwvaNVvn24sbmg=
228
+K
229
         AXoQ=3D=3D
230
ARC-Message-Signature: i=3D1; a=3Drsa-sha256; c=3Drelaxed/relaxed; d=3Dgoog=
231
le.com; s=3Darc-20160816;
232
        h=3Dlist-unsubscribe:list-subscribe:list-post:list-owner:list-help
233
         :list-archive:archived-at:list-id:precedence:message-id-hash
234
         :in-reply-to:from:references:to:content-language:subject:user-agen=
235
t
236
         :mime-version:date:message-id;
237
        bh=3DNwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=3D;
238
        b=3DlRfnkKpA20PQ492f09GZ96QqBCLkOo2yIrQLTTx/GNk8g8KYUkk+oo/7Ei8nxxE=
239
77x
240
         lmFFEaJccjUBlQHOFJXDYcQYyT/bdauLXCHpFm0IyUf88ClvVWZc/drOTFgk9aurzo=
241
Xh
242
         ++NmJ6WD0ii4WWF1TW/m28d1Hb3A5fPiCxGRb4XZjSbOF6Lk7AnwI/p9H8Dew8AKmk=
243
zA
244
         Syj2Pev5oLn3grHgNhD5lSuTtGLkioZO23PuAaILzoe5IDWrS9fIaI3IZtlsmNBUih=
245
Wx
246
         ibP54A+ioC6NbgEvgl42AnLhJmJpSh/AhI8vLfd8Z+0cNK+QZu1i1gvtwEhDYvD7V2=
247
sg
248
         Ccqw=3D=3D
249
ARC-Authentication-Results: i=3D1; mx.google.com;
250
       spf=3Dpass (google.com: domain of users-bounces@lists.opensuse.org d=
251
esignates 2001:67c:2178:8::18 as permitted sender) smtp.mailfrom=3Dusers-bo=
252
unces@lists.opensuse.org;
253
       dmarc=3Dfail (p=3DNONE sp=3DNONE dis=3DNONE) header.from=3Dtelefonic=
254
a.net
255
Return-Path: robin.listas@telefonica.net
256
Received-SPF: pass (google.com: domain of users-bounces@lists.opensuse.org =
257
designates 2001:67c:2178:8::18 as permitted sender) client-ip=3D2001:67c:21=
258
78:8::18;
259
Authentication-Results-Original: mx.google.com;       spf=3Dpass (google.co=
260
m:
261
 domain of users-bounces@lists.opensuse.org designates 2001:67c:2178:8::18 =
262
as
263
 permitted sender) smtp.mailfrom=3Dusers-bounces@lists.opensuse.org;
264
       dmarc=3Dfail (p=3DNONE sp=3DNONE dis=3DNONE) header.from=3Dtelefonic=
265
a.net
266
X-Spam-Checker-Version: SpamAssassin 3.4.5 (2021-03-20) on mx2
267
X-Spam-Level:
268
X-Spam-Status: No, score=3D0.1 required=3D5.0 tests=3DDMARC_NONE,FREEMAIL_F=
269
ROM,
270
        NICE_REPLY_A,SPF_HELO_NONE autolearn=3Ddisabled version=3D3.4.5
271
X-Spam-Virus: No
272
X-Virus-Scanned: amavisd-new at valinor
273
Message-ID: <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
274
Date: Thu, 11 Aug 2022 18:28:21 +0200
275
MIME-Version: 1.0
276
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:91.0) Gecko/20100101
277
 Thunderbird/91.12.0
278
Subject: Re: [oS-en] Recovering dead text file
279
Content-Language: en-CA
280
To: oS-EN <users@lists.opensuse.org>
281
References: <ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net>
282
 <fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com>
283
 <95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net>
284
 <20220811112640.yothu2esdyy264nx@grusum.dhaller.de>
285
 <9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net>
286
 <20220811132813.GQ22216@wahoo.no-ip.org>
287
 <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
288
From: "Carlos E. R." <robin.listas@telefonica.net>
289
In-Reply-To: <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
290
Content-Type: multipart/signed; micalg=3Dpgp-sha256;
291
 protocol=3D"application/pgp-signature";
292
 boundary=3D"------------N3z4990QrR8wFqNb7EF9Cg0r"
293
X-TnetOut-Country: IP: 79.150.123.19 | Country: ES
294
X-TnetOut-Information: AntiSPAM and AntiVIRUS on relayout02
295
X-TnetOut-MsgID: 4M3XKy0QlPzdbfk.A553F
296
X-TnetOut-SpamCheck: no es spam (whitelisted), clean
297
X-TnetOut-From: robin.listas@telefonica.net
298
X-TnetOut-Watermark: 1660840102.1529@5uugFEPJkyEBjB7XwBJgLA
299
Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
300
X-Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
301
X-MailFrom: SRS0=3DHh0y=3DYP=3Dtelefonica.net=3Drobin.listas@opensuse.org
302
X-Mailman-Rule-Misses: dmarc-mitigation; no-senders; approved; emergency; l=
303
oop; banned-address; member-moderation; header-match-config-1; header-match=
304
-config-2; header-match-config-3; nonmember-moderation; administrivia; impl=
305
icit-dest; max-recipients; max-size; news-moderation; no-subject; digests; =
306
suspicious-header
307
X-Mailman-Version: 3.3.5
308
Precedence: list
309
List-Id: openSUSE Users <users.lists.opensuse.org>
310
Archived-At: <https://lists.opensuse.org/archives/list/users@lists.opensuse=
311
.org/message/XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q/>
312
List-Archive: <https://lists.opensuse.org/archives/list/users@lists.opensus=
313
e.org/>
314
List-Help: <mailto:users-request@lists.opensuse.org?subject=3Dhelp>
315
List-Owner: <mailto:users-owner@lists.opensuse.org>
316
List-Post: <mailto:users@lists.opensuse.org>
317
List-Subscribe: <mailto:users-join@lists.opensuse.org>
318
List-Unsubscribe: <mailto:users-leave@lists.opensuse.org>
319
X-IncomingHeaderCount: 64
320
X-EOPAttributedMessage: 0
321
X-EOPTenantAttributedMessage: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa:0
322
X-MS-PublicTrafficType: Email
323
X-MS-UserLastLogonTime: 8/11/2022 4:22:34 PM
324
X-MS-Office365-Filtering-Correlation-Id: 152c8825-f3b3-41c3-482b-08da7bb68b=
325
d8
326
X-MS-TrafficTypeDiagnostic:
327
        AS8PR01MB7381:EE_|GV1PR01MB8580:EE_|GV1PR01MB8849:EE_
328
X-MS-Exchange-EOPDirect: true
329
X-Sender-IP: 209.85.222.41
330
X-SID-PRA: ROBIN.LISTAS@TELEFONICA.NET
331
X-SID-Result: NONE
332
X-Microsoft-Antispam: BCL:5;
333
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 11 Aug 2022 16:28:38.6505
334
 (UTC)
335
X-MS-Exchange-CrossTenant-Network-Message-Id: 152c8825-f3b3-41c3-482b-08da7=
336
bb68bd8
337
X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa
338
X-MS-Exchange-CrossTenant-AuthSource: AM7EUR06FT038.eop-eur06.prod.protecti=
339
on.outlook.com
340
X-MS-Exchange-CrossTenant-AuthAs: Anonymous
341
X-MS-Exchange-CrossTenant-FromEntityHeader: Internet
342
X-MS-Exchange-Transport-CrossTenantHeadersStamped: AS8PR01MB7381
343
X-MS-Exchange-Transport-EndToEndLatency: 00:00:00.5719616
344
X-MS-Exchange-Processed-By-BccFoldering: 15.20.5504.021
345
X-MS-Exchange-Inbox-Rules-Loop: gregormeier@outlook.com
346
X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-fc60a.templateTenant
347

    
348

    
349
--fa0b0883-f1a9-4970-993f-080a23243e7c
350
Content-Type: text/html; charset="us-ascii"
351
Content-Transfer-Encoding: quoted-printable
352

    
353
<html>
354
<Head></head><body>
355
<p><b><font color=3D"#000066" size=3D"3" face=3D"Arial">Delivery has failed=
356
 to these recipients or groups:</font></b></p>
357
<font color=3D"#000000" size=3D"2" face=3D"Tahoma"><p><a href=3D"mailto:amd=
358
lnx60@googlemail.com">amdlnx60@googlemail.com</a><br>
359
</font>
360
<font color=3D"#000000" size=3D"3" face=3D"Arial">Your message wasn't deliv=
361
ered because the recipient's email provider rejected it.<br>
362
</font>
363
<font color=3D"#000000" size=3D"2" face=3D"Tahoma"><br>
364
</p>
365
</font>
366
<br><br><br><br><br><br>
367
<font color=3D"#808080" size=3D"2" face=3D"Tahoma"><p><b>Diagnostic informa=
368
tion for administrators:</b></p>
369
<p>Generating server: GV1PR01MB8849.eurprd01.prod.exchangelabs.com<br>
370
</p>
371
<p>amdlnx60@googlemail.com<br>
372
Remote Server  returned '550-5.7.26 The MAIL FROM domain [telefonica.net] h=
373
as an SPF record with a hard
374
550-5.7.26 fail policy (-all) but it fails to pass SPF checks with the ip:
375
550-5.7.26 [104.47.12.57]. To best protect our users from spam and phishing=
376
,
377
550-5.7.26 the message has been blocked. Please visit
378
550-5.7.26  https://support.google.com/mail/answer/81126#authentication for=
379
 more
380
550 5.7.26 information. ec2-20020a170906b6c200b007306f2ffcc7si7119039ejb.34=
381
5 - gsmtp'<br>
382
</p>
383
<p>Original message headers:</p>
384
<pre>Received: from GV1PR01MB8580.eurprd01.prod.exchangelabs.com
385
 (2603:10a6:150:27::8) by GV1PR01MB8849.eurprd01.prod.exchangelabs.com
386
 (2603:10a6:150:2c::7) with Microsoft SMTP Server (version=3DTLS1_2,
387
 cipher=3DTLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.5504.14; Thu, 11 =
388
Aug
389
 2022 16:28:39 +0000
390
Resent-From: &lt;gregormeier@outlook.com&gt;
391
Received: from GV1PR01MB8580.eurprd01.prod.exchangelabs.com ([::1]) by
392
 GV1PR01MB8580.eurprd01.prod.exchangelabs.com ([fe80::7829:c80b:e85c:ace1%5=
393
])
394
 with Microsoft SMTP Server id 15.20.5504.021; Thu, 11 Aug 2022 16:28:39 +0=
395
000
396
ARC-Seal: i=3D2; a=3Drsa-sha256; s=3Darcselector9901; d=3Dmicrosoft.com; cv=
397
=3Dpass;
398
 b=3DMPlTu4giO1c33bMpZnoxxaZs9D52gLrgfqYcG4xOaR56TyIph+BPY8nWE4LgdVUWqkavAj=
399
/d4WKF1nGekX7Au88lvWlzQMl+o5j6RLmC5UCVe0M3KS19Kv0AGnBWlH4eO9PfNlS+fDTxeFkLd=
400
wi5KQnS7bQfYODSVnJ6LvFKHI6bnCLubR0Vjo2O3MIfgKubGjDH4WuB1oUVFwUcGIW/SMOTX5S6=
401
t8uBWBtIclOZ/8rURm/jCKadtQz7+4DpbvVOK5NnLQvjOPwd/drmhwrbC6qEBRwmdF9ZHsC8Fhh=
402
Pfnhnknz2knAdxgJ1HD9DsnTVOvQXaS6mUwstAEPsLJTO0w=3D=3D
403
ARC-Message-Signature: i=3D2; a=3Drsa-sha256; c=3Drelaxed/relaxed; d=3Dmicr=
404
osoft.com;
405
 s=3Darcselector9901;
406
 h=3DFrom:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-A=
407
ntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Ex=
408
change-AntiSpam-MessageData-1;
409
 bh=3DNwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=3D;
410
 b=3DXOFCCwSqnpV8fwPrefGzdp70qoHBbadEDC2OaqFwur2G/CpLOmc02Rwof43GfO55KVYlk/=
411
3cTHcYnb8zeUPJTsnm/uh+ybCLZtOXvnCQ2Mu0DMViJonoZPHmjQ47SeKodRLmbL4F/1Vx7T+gx=
412
3YFW7ZhAX8MG/1GHQ6Hy4Cv8gXPnStdrUTskj29aUPEygMsuNqozO/MyqJfqvqPHsDzmTIlzrij=
413
yTZR6Ubfw9ddtFAX5fluJvq+hokrv0RHvzh+t2JRm2UVTaOW+yzHYZDE1/pO0acKCNv9NvhJNHm=
414
dpzla02m6/xQxNSsX6vEyBllQGDu/ocNnrMti0VPJKIT73w=3D=3D
415
ARC-Authentication-Results: i=3D2; mx.microsoft.com 1; spf=3Dpass (sender i=
416
p is
417
 209.85.222.41) smtp.rcpttodomain=3Doutlook.com smtp.mailfrom=3Dgmail.com;
418
 dmarc=3Dfail (p=3Dnone sp=3Dnone pct=3D100) action=3Dnone header.from=3Dte=
419
lefonica.net;
420
 dkim=3Dnone (message not signed); arc=3Dpass (0 oda=3D0 ltdi=3D1)
421
Authentication-Results: spf=3Dpass (sender IP is 209.85.222.41)
422
 smtp.mailfrom=3Dgmail.com; dkim=3Dnone (message not signed)
423
 header.d=3Dnone;dmarc=3Dfail action=3Dnone header.from=3Dtelefonica.net;
424
Received-SPF: Pass (protection.outlook.com: domain of gmail.com designates
425
 209.85.222.41 as permitted sender) receiver=3Dprotection.outlook.com;
426
 client-ip=3D209.85.222.41; helo=3Dmail-ua1-f41.google.com; pr=3DC
427
X-IncomingTopHeaderMarker: OriginalChecksum:230E059A3302EEAC1D99788EFB7844E=
428
16974B3DB7D6F73130699072111760613;UpperCasedChecksum:444DDBADA0FEBAE8561634=
429
24CBCBFD54AA4440F33169EEFE09FF0E1F351A144F;SizeAsReceived:9590;Count:64
430
X-Google-DKIM-Signature: v=3D1; a=3Drsa-sha256; c=3Drelaxed/relaxed;
431
        d=3D1e100.net; s=3D20210112;
432
        h=3Dlist-unsubscribe:list-subscribe:list-post:list-owner:list-help
433
         :list-archive:archived-at:list-id:precedence:message-id-hash
434
         :in-reply-to:from:references:to:content-language:subject:user-agen=
435
t
436
         :mime-version:date:message-id:delivered-to:x-gm-message-state
437
         :x-original-authentication-results:from:to:cc;
438
        bh=3DNwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=3D;
439
        b=3DzeenLGI/nnJNzTJESMWYGs9D8iZK7rgTswIdha8Ox0Q4c8FTQHOn38PqZNSgkkn=
440
c4V
441
         ClZhJXt7ogkLp6yDOY4dQf+WQMxHN5sSNxSjurn3UQTHECYo24+sGfTgDhlRy04FQo=
442
sL
443
         XEPoQX/eaTeImeWRiM8/r3kZbFv9fC1DJGinOhL0eNPBmKLP6ArxQAdYcY9a8j/YsK=
444
fS
445
         eTikz0ggS6QbNNn9X4k8V69DycbatHRD7YGLNc2ik7/mXfCfzvHr7+OmTsomSNo5r3=
446
8a
447
         PKUoTQbkrKt+yOg8FpE++niEQh8lnToppmknL63Z2LfhbH2Wk1UWedUVHjL1ICdo5e=
448
xE
449
         qE9Q=3D=3D
450
X-Original-Authentication-Results: mx.google.com;       spf=3Dpass (google.=
451
com: domain of users-bounces@lists.opensuse.org designates 2001:67c:2178:8:=
452
:18 as permitted sender) smtp.mailfrom=3Dusers-bounces@lists.opensuse.org; =
453
      dmarc=3Dfail (p=3DNONE sp=3DNONE dis=3DNONE) header.from=3Dtelefonica=
454
.net
455
X-Gm-Message-State: ACgBeo3UXhHA789Eiukny8y5hY2nYEGmwVn72dvCuREh3SP4xKQm+LM=
456
D
457
	FFXKRSJYk0Hhfv6Un+/L02Wy7lnceYl4DwqWRh64l16xfj5JqWnTsw=3D=3D
458
X-Received: by 2002:ab0:49a9:0:b0:387:71ed:915c with SMTP id e38-20020ab049=
459
a9000000b0038771ed915cmr14652232uad.85.1660235317432;
460
        Thu, 11 Aug 2022 09:28:37 -0700 (PDT)
461
X-Forwarded-To: gregormeier@outlook.com
462
X-Forwarded-For: amdlnx60@gmail.com gregormeier@outlook.com
463
Delivered-To: amdlnx60@gmail.com
464
X-Google-Smtp-Source: AA6agR7ZBSkOaMAd0M+mIS/pjCsF9OO2/lY0Sy4S1ify8OWIqI/rd=
465
YYuBL8sXMlwXY4FiyVnTpLX
466
X-Received: by 2002:a05:600c:322a:b0:3a5:3dda:10b3 with SMTP id r42-20020a0=
467
5600c322a00b003a53dda10b3mr6129532wmp.125.1660235315919;
468
        Thu, 11 Aug 2022 09:28:35 -0700 (PDT)
469
ARC-Seal: i=3D1; a=3Drsa-sha256; t=3D1660235315; cv=3Dnone;
470
        d=3Dgoogle.com; s=3Darc-20160816;
471
        b=3DZHM/k3moYKdnUJ0VE2+atgZHuhc71IbmKWugXVDq2BtYqORI6+EfqVr59tzJ2UV=
472
M0d
473
         y7RRWegmewn9zNyzUeeYt3Dnb2fFr31cK2jpSTOCPSLwkcAclVyfOCGxyAOFcurSSS=
474
cP
475
         B6qnhLP/sKLmVzFj18uDR6GwbyJF5oLtqLe8TlHFjD07+1mWG7gP9SFX2w/AQTm/Ib=
476
Ck
477
         qfSg5XH2e4qWb9cHuIiihOmGo2OGSDL6bnssMFYNJriIpfI9uYmPLRhJ5pFV0jnhQA=
478
B+
479
         IlK4SxKlwF6dCKJhigXrnjjKW/tZGU2wQ+pTfP5PJhrSwlZV2apTRwvaNVvn24sbmg=
480
+K
481
         AXoQ=3D=3D
482
ARC-Message-Signature: i=3D1; a=3Drsa-sha256; c=3Drelaxed/relaxed; d=3Dgoog=
483
le.com; s=3Darc-20160816;
484
        h=3Dlist-unsubscribe:list-subscribe:list-post:list-owner:list-help
485
         :list-archive:archived-at:list-id:precedence:message-id-hash
486
         :in-reply-to:from:references:to:content-language:subject:user-agen=
487
t
488
         :mime-version:date:message-id;
489
        bh=3DNwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=3D;
490
        b=3DlRfnkKpA20PQ492f09GZ96QqBCLkOo2yIrQLTTx/GNk8g8KYUkk+oo/7Ei8nxxE=
491
77x
492
         lmFFEaJccjUBlQHOFJXDYcQYyT/bdauLXCHpFm0IyUf88ClvVWZc/drOTFgk9aurzo=
493
Xh
494
         ++NmJ6WD0ii4WWF1TW/m28d1Hb3A5fPiCxGRb4XZjSbOF6Lk7AnwI/p9H8Dew8AKmk=
495
zA
496
         Syj2Pev5oLn3grHgNhD5lSuTtGLkioZO23PuAaILzoe5IDWrS9fIaI3IZtlsmNBUih=
497
Wx
498
         ibP54A+ioC6NbgEvgl42AnLhJmJpSh/AhI8vLfd8Z+0cNK+QZu1i1gvtwEhDYvD7V2=
499
sg
500
         Ccqw=3D=3D
501
ARC-Authentication-Results: i=3D1; mx.google.com;
502
       spf=3Dpass (google.com: domain of users-bounces@lists.opensuse.org d=
503
esignates 2001:67c:2178:8::18 as permitted sender) smtp.mailfrom=3Dusers-bo=
504
unces@lists.opensuse.org;
505
       dmarc=3Dfail (p=3DNONE sp=3DNONE dis=3DNONE) header.from=3Dtelefonic=
506
a.net
507
Return-Path: robin.listas@telefonica.net
508
Received-SPF: pass (google.com: domain of users-bounces@lists.opensuse.org =
509
designates 2001:67c:2178:8::18 as permitted sender) client-ip=3D2001:67c:21=
510
78:8::18;
511
Authentication-Results-Original: mx.google.com;       spf=3Dpass (google.co=
512
m:
513
 domain of users-bounces@lists.opensuse.org designates 2001:67c:2178:8::18 =
514
as
515
 permitted sender) smtp.mailfrom=3Dusers-bounces@lists.opensuse.org;
516
       dmarc=3Dfail (p=3DNONE sp=3DNONE dis=3DNONE) header.from=3Dtelefonic=
517
a.net
518
X-Spam-Checker-Version: SpamAssassin 3.4.5 (2021-03-20) on mx2
519
X-Spam-Level:
520
X-Spam-Status: No, score=3D0.1 required=3D5.0 tests=3DDMARC_NONE,FREEMAIL_F=
521
ROM,
522
	NICE_REPLY_A,SPF_HELO_NONE autolearn=3Ddisabled version=3D3.4.5
523
X-Spam-Virus: No
524
X-Virus-Scanned: amavisd-new at valinor
525
Message-ID: &lt;1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net&gt;
526
Date: Thu, 11 Aug 2022 18:28:21 +0200
527
MIME-Version: 1.0
528
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:91.0) Gecko/20100101
529
 Thunderbird/91.12.0
530
Subject: Re: [oS-en] Recovering dead text file
531
Content-Language: en-CA
532
To: oS-EN &lt;users@lists.opensuse.org&gt;
533
References: &lt;ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net&gt;
534
 &lt;fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com&gt;
535
 &lt;95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net&gt;
536
 &lt;20220811112640.yothu2esdyy264nx@grusum.dhaller.de&gt;
537
 &lt;9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net&gt;
538
 &lt;20220811132813.GQ22216@wahoo.no-ip.org&gt;
539
 &lt;869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org&gt;
540
From: &quot;Carlos E. R.&quot; &lt;robin.listas@telefonica.net&gt;
541
In-Reply-To: &lt;869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org&gt;
542
Content-Type: multipart/signed; micalg=3Dpgp-sha256;
543
 protocol=3D&quot;application/pgp-signature&quot;;
544
 boundary=3D&quot;------------N3z4990QrR8wFqNb7EF9Cg0r&quot;
545
X-TnetOut-Country: IP: 79.150.123.19 | Country: ES
546
X-TnetOut-Information: AntiSPAM and AntiVIRUS on relayout02
547
X-TnetOut-MsgID: 4M3XKy0QlPzdbfk.A553F
548
X-TnetOut-SpamCheck: no es spam (whitelisted), clean
549
X-TnetOut-From: robin.listas@telefonica.net
550
X-TnetOut-Watermark: 1660840102.1529@5uugFEPJkyEBjB7XwBJgLA
551
Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
552
X-Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
553
X-MailFrom: SRS0=3DHh0y=3DYP=3Dtelefonica.net=3Drobin.listas@opensuse.org
554
X-Mailman-Rule-Misses: dmarc-mitigation; no-senders; approved; emergency; l=
555
oop; banned-address; member-moderation; header-match-config-1; header-match=
556
-config-2; header-match-config-3; nonmember-moderation; administrivia; impl=
557
icit-dest; max-recipients; max-size; news-moderation; no-subject; digests; =
558
suspicious-header
559
X-Mailman-Version: 3.3.5
560
Precedence: list
561
List-Id: openSUSE Users &lt;users.lists.opensuse.org&gt;
562
Archived-At: &lt;https://lists.opensuse.org/archives/list/users@lists.opens=
563
use.org/message/XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q/&gt;
564
List-Archive: &lt;https://lists.opensuse.org/archives/list/users@lists.open=
565
suse.org/&gt;
566
List-Help: &lt;mailto:users-request@lists.opensuse.org?subject=3Dhelp&gt;
567
List-Owner: &lt;mailto:users-owner@lists.opensuse.org&gt;
568
List-Post: &lt;mailto:users@lists.opensuse.org&gt;
569
List-Subscribe: &lt;mailto:users-join@lists.opensuse.org&gt;
570
List-Unsubscribe: &lt;mailto:users-leave@lists.opensuse.org&gt;
571
X-IncomingHeaderCount: 64
572
X-EOPAttributedMessage: 0
573
X-EOPTenantAttributedMessage: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa:0
574
X-MS-PublicTrafficType: Email
575
X-MS-UserLastLogonTime: 8/11/2022 4:22:34 PM
576
X-MS-Office365-Filtering-Correlation-Id: 152c8825-f3b3-41c3-482b-08da7bb68b=
577
d8
578
X-MS-TrafficTypeDiagnostic:
579
	AS8PR01MB7381:EE_|GV1PR01MB8580:EE_|GV1PR01MB8849:EE_
580
X-MS-Exchange-EOPDirect: true
581
X-Sender-IP: 209.85.222.41
582
X-SID-PRA: ROBIN.LISTAS@TELEFONICA.NET
583
X-SID-Result: NONE
584
X-Microsoft-Antispam: BCL:5;
585
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 11 Aug 2022 16:28:38.6505
586
 (UTC)
587
X-MS-Exchange-CrossTenant-Network-Message-Id: 152c8825-f3b3-41c3-482b-08da7=
588
bb68bd8
589
X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa
590
X-MS-Exchange-CrossTenant-AuthSource: AM7EUR06FT038.eop-eur06.prod.protecti=
591
on.outlook.com
592
X-MS-Exchange-CrossTenant-AuthAs: Anonymous
593
X-MS-Exchange-CrossTenant-FromEntityHeader: Internet
594
X-MS-Exchange-Transport-CrossTenantHeadersStamped: AS8PR01MB7381
595
X-MS-Exchange-Transport-EndToEndLatency: 00:00:00.5719616
596
X-MS-Exchange-Processed-By-BccFoldering: 15.20.5504.021
597
X-MS-Exchange-Inbox-Rules-Loop: gregormeier@outlook.com
598
X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-fc60a.templateTenant
599
</pre>
600
</font>
601
</body>
602
</html>=
603

    
604
--fa0b0883-f1a9-4970-993f-080a23243e7c--
605

    
606
--58819725-0049-4b88-9e9a-811e69eafffe
607
Content-Type: message/delivery-status
608

    
609
Reporting-MTA: dns;GV1PR01MB8849.eurprd01.prod.exchangelabs.com
610
Received-From-MTA: dns;GV1PR01MB8580.eurprd01.prod.exchangelabs.com
611
Arrival-Date: Thu, 11 Aug 2022 16:28:39 +0000
612

    
613
Final-Recipient: rfc822;amdlnx60@googlemail.com
614
Action: failed
615
Status: 5.7.26
616
Diagnostic-Code: smtp;550-5.7.26 The MAIL FROM domain [telefonica.net] has an SPF record with a hard
617
 550-5.7.26 fail policy (-all) but it fails to pass SPF checks with the ip:
618
 550-5.7.26 [104.47.12.57]. To best protect our users from spam and phishing,
619
 550-5.7.26 the message has been blocked. Please visit
620
 550-5.7.26  https://support.google.com/mail/answer/81126#authentication for more
621
 550 5.7.26 information. ec2-20020a170906b6c200b007306f2ffcc7si7119039ejb.345 - gsmtp
622

    
623

    
624
--58819725-0049-4b88-9e9a-811e69eafffe
625
Content-Type: message/rfc822
626

    
627
Received: from GV1PR01MB8580.eurprd01.prod.exchangelabs.com
628
 (2603:10a6:150:27::8) by GV1PR01MB8849.eurprd01.prod.exchangelabs.com
629
 (2603:10a6:150:2c::7) with Microsoft SMTP Server (version=TLS1_2,
630
 cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.5504.14; Thu, 11 Aug
631
 2022 16:28:39 +0000
632
Resent-From: <gregormeier@outlook.com>
633
Received: from GV1PR01MB8580.eurprd01.prod.exchangelabs.com ([::1]) by
634
 GV1PR01MB8580.eurprd01.prod.exchangelabs.com ([fe80::7829:c80b:e85c:ace1%5])
635
 with Microsoft SMTP Server id 15.20.5504.021; Thu, 11 Aug 2022 16:28:39 +0000
636
ARC-Seal: i=2; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=pass;
637
 b=MPlTu4giO1c33bMpZnoxxaZs9D52gLrgfqYcG4xOaR56TyIph+BPY8nWE4LgdVUWqkavAj/d4WKF1nGekX7Au88lvWlzQMl+o5j6RLmC5UCVe0M3KS19Kv0AGnBWlH4eO9PfNlS+fDTxeFkLdwi5KQnS7bQfYODSVnJ6LvFKHI6bnCLubR0Vjo2O3MIfgKubGjDH4WuB1oUVFwUcGIW/SMOTX5S6t8uBWBtIclOZ/8rURm/jCKadtQz7+4DpbvVOK5NnLQvjOPwd/drmhwrbC6qEBRwmdF9ZHsC8FhhPfnhnknz2knAdxgJ1HD9DsnTVOvQXaS6mUwstAEPsLJTO0w==
638
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com;
639
 s=arcselector9901;
640
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1;
641
 bh=NwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=;
642
 b=XOFCCwSqnpV8fwPrefGzdp70qoHBbadEDC2OaqFwur2G/CpLOmc02Rwof43GfO55KVYlk/3cTHcYnb8zeUPJTsnm/uh+ybCLZtOXvnCQ2Mu0DMViJonoZPHmjQ47SeKodRLmbL4F/1Vx7T+gx3YFW7ZhAX8MG/1GHQ6Hy4Cv8gXPnStdrUTskj29aUPEygMsuNqozO/MyqJfqvqPHsDzmTIlzrijyTZR6Ubfw9ddtFAX5fluJvq+hokrv0RHvzh+t2JRm2UVTaOW+yzHYZDE1/pO0acKCNv9NvhJNHmdpzla02m6/xQxNSsX6vEyBllQGDu/ocNnrMti0VPJKIT73w==
643
ARC-Authentication-Results: i=2; mx.microsoft.com 1; spf=pass (sender ip is
644
 209.85.222.41) smtp.rcpttodomain=outlook.com smtp.mailfrom=gmail.com;
645
 dmarc=fail (p=none sp=none pct=100) action=none header.from=telefonica.net;
646
 dkim=none (message not signed); arc=pass (0 oda=0 ltdi=1)
647
Authentication-Results: spf=pass (sender IP is 209.85.222.41)
648
 smtp.mailfrom=gmail.com; dkim=none (message not signed)
649
 header.d=none;dmarc=fail action=none header.from=telefonica.net;
650
Received-SPF: Pass (protection.outlook.com: domain of gmail.com designates
651
 209.85.222.41 as permitted sender) receiver=protection.outlook.com;
652
 client-ip=209.85.222.41; helo=mail-ua1-f41.google.com; pr=C
653
X-IncomingTopHeaderMarker: OriginalChecksum:230E059A3302EEAC1D99788EFB7844E16974B3DB7D6F73130699072111760613;UpperCasedChecksum:444DDBADA0FEBAE856163424CBCBFD54AA4440F33169EEFE09FF0E1F351A144F;SizeAsReceived:9590;Count:64
654
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
655
        d=1e100.net; s=20210112;
656
        h=list-unsubscribe:list-subscribe:list-post:list-owner:list-help
657
         :list-archive:archived-at:list-id:precedence:message-id-hash
658
         :in-reply-to:from:references:to:content-language:subject:user-agent
659
         :mime-version:date:message-id:delivered-to:x-gm-message-state
660
         :x-original-authentication-results:from:to:cc;
661
        bh=NwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=;
662
        b=zeenLGI/nnJNzTJESMWYGs9D8iZK7rgTswIdha8Ox0Q4c8FTQHOn38PqZNSgkknc4V
663
         ClZhJXt7ogkLp6yDOY4dQf+WQMxHN5sSNxSjurn3UQTHECYo24+sGfTgDhlRy04FQosL
664
         XEPoQX/eaTeImeWRiM8/r3kZbFv9fC1DJGinOhL0eNPBmKLP6ArxQAdYcY9a8j/YsKfS
665
         eTikz0ggS6QbNNn9X4k8V69DycbatHRD7YGLNc2ik7/mXfCfzvHr7+OmTsomSNo5r38a
666
         PKUoTQbkrKt+yOg8FpE++niEQh8lnToppmknL63Z2LfhbH2Wk1UWedUVHjL1ICdo5exE
667
         qE9Q==
668
X-Original-Authentication-Results: mx.google.com;       spf=pass (google.com: domain of users-bounces@lists.opensuse.org designates 2001:67c:2178:8::18 as permitted sender) smtp.mailfrom=users-bounces@lists.opensuse.org;       dmarc=fail (p=NONE sp=NONE dis=NONE) header.from=telefonica.net
669
X-Gm-Message-State: ACgBeo3UXhHA789Eiukny8y5hY2nYEGmwVn72dvCuREh3SP4xKQm+LMD
670
	FFXKRSJYk0Hhfv6Un+/L02Wy7lnceYl4DwqWRh64l16xfj5JqWnTsw==
671
X-Received: by 2002:ab0:49a9:0:b0:387:71ed:915c with SMTP id e38-20020ab049a9000000b0038771ed915cmr14652232uad.85.1660235317432;
672
        Thu, 11 Aug 2022 09:28:37 -0700 (PDT)
673
X-Forwarded-To: gregormeier@outlook.com
674
X-Forwarded-For: amdlnx60@gmail.com gregormeier@outlook.com
675
Delivered-To: amdlnx60@gmail.com
676
X-Google-Smtp-Source: AA6agR7ZBSkOaMAd0M+mIS/pjCsF9OO2/lY0Sy4S1ify8OWIqI/rdYYuBL8sXMlwXY4FiyVnTpLX
677
X-Received: by 2002:a05:600c:322a:b0:3a5:3dda:10b3 with SMTP id r42-20020a05600c322a00b003a53dda10b3mr6129532wmp.125.1660235315919;
678
        Thu, 11 Aug 2022 09:28:35 -0700 (PDT)
679
ARC-Seal: i=1; a=rsa-sha256; t=1660235315; cv=none;
680
        d=google.com; s=arc-20160816;
681
        b=ZHM/k3moYKdnUJ0VE2+atgZHuhc71IbmKWugXVDq2BtYqORI6+EfqVr59tzJ2UVM0d
682
         y7RRWegmewn9zNyzUeeYt3Dnb2fFr31cK2jpSTOCPSLwkcAclVyfOCGxyAOFcurSSScP
683
         B6qnhLP/sKLmVzFj18uDR6GwbyJF5oLtqLe8TlHFjD07+1mWG7gP9SFX2w/AQTm/IbCk
684
         qfSg5XH2e4qWb9cHuIiihOmGo2OGSDL6bnssMFYNJriIpfI9uYmPLRhJ5pFV0jnhQAB+
685
         IlK4SxKlwF6dCKJhigXrnjjKW/tZGU2wQ+pTfP5PJhrSwlZV2apTRwvaNVvn24sbmg+K
686
         AXoQ==
687
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
688
        h=list-unsubscribe:list-subscribe:list-post:list-owner:list-help
689
         :list-archive:archived-at:list-id:precedence:message-id-hash
690
         :in-reply-to:from:references:to:content-language:subject:user-agent
691
         :mime-version:date:message-id;
692
        bh=NwzzTuf9eGtFZRueCqtnm2rZMBzBKsJQwZpNr4a3KIM=;
693
        b=lRfnkKpA20PQ492f09GZ96QqBCLkOo2yIrQLTTx/GNk8g8KYUkk+oo/7Ei8nxxE77x
694
         lmFFEaJccjUBlQHOFJXDYcQYyT/bdauLXCHpFm0IyUf88ClvVWZc/drOTFgk9aurzoXh
695
         ++NmJ6WD0ii4WWF1TW/m28d1Hb3A5fPiCxGRb4XZjSbOF6Lk7AnwI/p9H8Dew8AKmkzA
696
         Syj2Pev5oLn3grHgNhD5lSuTtGLkioZO23PuAaILzoe5IDWrS9fIaI3IZtlsmNBUihWx
697
         ibP54A+ioC6NbgEvgl42AnLhJmJpSh/AhI8vLfd8Z+0cNK+QZu1i1gvtwEhDYvD7V2sg
698
         Ccqw==
699
ARC-Authentication-Results: i=1; mx.google.com;
700
       spf=pass (google.com: domain of users-bounces@lists.opensuse.org designates 2001:67c:2178:8::18 as permitted sender) smtp.mailfrom=users-bounces@lists.opensuse.org;
701
       dmarc=fail (p=NONE sp=NONE dis=NONE) header.from=telefonica.net
702
Return-Path: robin.listas@telefonica.net
703
Received-SPF: pass (google.com: domain of users-bounces@lists.opensuse.org designates 2001:67c:2178:8::18 as permitted sender) client-ip=2001:67c:2178:8::18;
704
Authentication-Results-Original: mx.google.com;       spf=pass (google.com:
705
 domain of users-bounces@lists.opensuse.org designates 2001:67c:2178:8::18 as
706
 permitted sender) smtp.mailfrom=users-bounces@lists.opensuse.org;
707
       dmarc=fail (p=NONE sp=NONE dis=NONE) header.from=telefonica.net
708
X-Spam-Checker-Version: SpamAssassin 3.4.5 (2021-03-20) on mx2
709
X-Spam-Level:
710
X-Spam-Status: No, score=0.1 required=5.0 tests=DMARC_NONE,FREEMAIL_FROM,
711
	NICE_REPLY_A,SPF_HELO_NONE autolearn=disabled version=3.4.5
712
X-Spam-Virus: No
713
X-Virus-Scanned: amavisd-new at valinor
714
Message-ID: <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
715
Date: Thu, 11 Aug 2022 18:28:21 +0200
716
MIME-Version: 1.0
717
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:91.0) Gecko/20100101
718
 Thunderbird/91.12.0
719
Subject: Re: [oS-en] Recovering dead text file
720
Content-Language: en-CA
721
To: oS-EN <users@lists.opensuse.org>
722
References: <ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net>
723
 <fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com>
724
 <95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net>
725
 <20220811112640.yothu2esdyy264nx@grusum.dhaller.de>
726
 <9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net>
727
 <20220811132813.GQ22216@wahoo.no-ip.org>
728
 <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
729
From: "Carlos E. R." <robin.listas@telefonica.net>
730
In-Reply-To: <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
731
Content-Type: multipart/signed; micalg=pgp-sha256;
732
 protocol="application/pgp-signature";
733
 boundary="------------N3z4990QrR8wFqNb7EF9Cg0r"
734
X-TnetOut-Country: IP: 79.150.123.19 | Country: ES
735
X-TnetOut-Information: AntiSPAM and AntiVIRUS on relayout02
736
X-TnetOut-MsgID: 4M3XKy0QlPzdbfk.A553F
737
X-TnetOut-SpamCheck: no es spam (whitelisted), clean
738
X-TnetOut-From: robin.listas@telefonica.net
739
X-TnetOut-Watermark: 1660840102.1529@5uugFEPJkyEBjB7XwBJgLA
740
Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
741
X-Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
742
X-MailFrom: SRS0=Hh0y=YP=telefonica.net=robin.listas@opensuse.org
743
X-Mailman-Rule-Misses: dmarc-mitigation; no-senders; approved; emergency; loop; banned-address; member-moderation; header-match-config-1; header-match-config-2; header-match-config-3; nonmember-moderation; administrivia; implicit-dest; max-recipients; max-size; news-moderation; no-subject; digests; suspicious-header
744
X-Mailman-Version: 3.3.5
745
Precedence: list
746
List-Id: openSUSE Users <users.lists.opensuse.org>
747
Archived-At: <https://lists.opensuse.org/archives/list/users@lists.opensuse.org/message/XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q/>
748
List-Archive: <https://lists.opensuse.org/archives/list/users@lists.opensuse.org/>
749
List-Help: <mailto:users-request@lists.opensuse.org?subject=help>
750
List-Owner: <mailto:users-owner@lists.opensuse.org>
751
List-Post: <mailto:users@lists.opensuse.org>
752
List-Subscribe: <mailto:users-join@lists.opensuse.org>
753
List-Unsubscribe: <mailto:users-leave@lists.opensuse.org>
754
X-IncomingHeaderCount: 64
755
X-EOPAttributedMessage: 0
756
X-EOPTenantAttributedMessage: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa:0
757
X-MS-PublicTrafficType: Email
758
X-MS-UserLastLogonTime: 8/11/2022 4:22:34 PM
759
X-MS-Office365-Filtering-Correlation-Id: 152c8825-f3b3-41c3-482b-08da7bb68bd8
760
X-MS-TrafficTypeDiagnostic:
761
 AS8PR01MB7381:EE_|GV1PR01MB8580:EE_|GV1PR01MB8849:EE_
762
X-MS-Exchange-EOPDirect: true
763
X-Sender-IP: 209.85.222.41
764
X-SID-PRA: ROBIN.LISTAS@TELEFONICA.NET
765
X-SID-Result: NONE
766
X-Microsoft-Antispam: BCL:5;
767
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 11 Aug 2022 16:28:38.6505
768
 (UTC)
769
X-MS-Exchange-CrossTenant-Network-Message-Id: 152c8825-f3b3-41c3-482b-08da7bb68bd8
770
X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa
771
X-MS-Exchange-CrossTenant-AuthSource: AM7EUR06FT038.eop-eur06.prod.protection.outlook.com
772
X-MS-Exchange-CrossTenant-AuthAs: Anonymous
773
X-MS-Exchange-CrossTenant-FromEntityHeader: Internet
774
X-MS-Exchange-Transport-CrossTenantHeadersStamped: AS8PR01MB7381
775
X-MS-Exchange-Transport-EndToEndLatency: 00:00:00.5719616
776
X-MS-Exchange-Processed-By-BccFoldering: 15.20.5504.021
777
X-MS-Exchange-Inbox-Rules-Loop: gregormeier@outlook.com
778
X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-fc60a.templateTenant
779

    
780
--------------N3z4990QrR8wFqNb7EF9Cg0r
781
Content-Type: multipart/mixed; boundary="------------nn2XDWNWL3yqreADLJ0weXbT";
782
 protected-headers="v1"
783
From: "Carlos E. R." <robin.listas@telefonica.net>
784
To: oS-EN <users@lists.opensuse.org>
785
Message-ID: <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
786
Subject: Re: [oS-en] Recovering dead text file
787
References: <ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net>
788
 <fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com>
789
 <95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net>
790
 <20220811112640.yothu2esdyy264nx@grusum.dhaller.de>
791
 <9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net>
792
 <20220811132813.GQ22216@wahoo.no-ip.org>
793
 <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
794
In-Reply-To: <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
795

    
796
--------------nn2XDWNWL3yqreADLJ0weXbT
797
Content-Type: text/plain; charset=UTF-8; format=flowed
798
Content-Transfer-Encoding: base64
799

    
800
T24gMjAyMi0wOC0xMSAxNzo0NSwgamRkQGRvZGluLm9yZyB3cm90ZToNCj4gTGUgMTEvMDgv
801
MjAyMiDDoCAxNToyOCwgUGF0cmljayBTaGFuYWhhbiBhIMOpY3JpdMKgOg0KPiANCj4+IEkg
802
c2VlIHR3byBwYXRocywgcmVpbnN0YWxsIGpvZS4gYW5kL29yIHJlbW92ZSB+Ly5qb2VyYyBh
803
bmQgcmVpbmFibGUgZWFjaA0KPj4gb3B0aW9uIG9uZSBvciBhIGZldyBhdCBhIHRpbWUgdW50
804
aWwgeW91IGZpbmQgY3VscHJldC4NCj4+DQo+Pg0KPiBqdXN0IGZvciBpbmZvLiBJIHJlYWQg
805
dGhpcyB0aHJlYWQsIGJ1dCBuZXZlciB1c2VkIGpvZSBwcmV2aW91c2x5IA0KPiAob3BlblNV
806
U0UgMTUuMykNCj4gDQo+IGFmdGVyIGxhdW5jaGluZyBqb2UgKGp1c3QgImpvZSA8UkM+Iiks
807
IHR5cGluZyBzb21lIHRleHQgYW5kIGNsb3NpbmcgdGhlIA0KPiB0ZXJtaW5hbCwgSSBoYXZl
808
ICpubyogam9lIGZpbGUgYXQgYWxsIGJ1dCBhIC5qb2Vfc3RhdGUNCj4gDQo+IG5vIC5qb2Vy
809
Yywgbm8gREVBRC4uLiB0aGluZw0KDQpJbnN0ZWFkIG9mIGNsb3NpbmcgdGhlIHRlcm1pbmFs
810
LCB1c2UgImtpbGwge1BJRH0iIG9yICJraWxsYWxsIGpvZSINCg0KSSBqdXN0IGRpZCB0aGF0
811
LCBubyBkZWFkIHRoaW5nLg0KDQpUaGVuIEkgbW92ZWQgdGhlICIuam9lX3N0YXRlIiBmaWxl
812
IGFuZCB0cmllZCBhZ2FpbiwgYW5kIG9uIGtpbGwgSSBnb3Q6DQoNCioqKiBKT0Ugd2FzIGFi
813
b3J0ZWQgYnkgVU5JWCBzaWduYWwgMTUuICBCdWZmZXJzIHNhdmVkIGluIERFQURKT0UNCg0K
814
DQphbmQgc3VyZSBlbm91Z2gsIHRoZSBERUFESk9FIGZpbGUgd2FzIGluIHRoZSBjdXJyZW50
815
IGRpcmVjdG9yeSBydW5uaW5nIA0KdGhlIGVkaXRvciBwcm9ncmFtLg0KDQoNCi0tIA0KQ2hl
816
ZXJzIC8gU2FsdWRvcywNCg0KCQlDYXJsb3MgRS4gUi4NCgkJKGZyb20gMTUuMyB4ODZfNjQg
817
YXQgVGVsY29udGFyKQ0K
818

    
819
--------------nn2XDWNWL3yqreADLJ0weXbT--
820

    
821
--------------N3z4990QrR8wFqNb7EF9Cg0r
822
Content-Type: application/pgp-signature; name="OpenPGP_signature.asc"
823
Content-Description: OpenPGP digital signature
824
Content-Disposition: attachment; filename="OpenPGP_signature"
825

    
826
-----BEGIN PGP SIGNATURE-----
827

    
828
wmMEABEIACMWIQQZEb51mJKK1KpcU/W1MxgcbY1H1QUCYvUuJQUDAAAAAAAKCRC1MxgcbY1H1ZdF
829
AJ4/wbqmjNtrmfWApfZiJ7J0s92s8wCeNme3Rf0xeJHSIIQ26ucLQ62TgaU=
830
=jHRu
831
-----END PGP SIGNATURE-----
832

    
833
--------------N3z4990QrR8wFqNb7EF9Cg0r--
834

    
835
--58819725-0049-4b88-9e9a-811e69eafffe--
836

    
837
From cer@Telcontar.valinor Thu Aug 11 18:28:43 2022 +0200
838
Return-Path: <>
839
Delivered-To: robin.listas@telefonica.net
840
Received: from dovector04.e.movistar.es ([217.116.1.119])
841
	by lda06.e.movistar.es (Dovecot) with LMTP id H0K2FTsu9WLUDwAAdnA+5w
842
	for <robin.listas@telefonica.net>; Thu, 11 Aug 2022 18:28:43 +0200
843
Received: from asavin02.e.movistar.es ([217.116.1.119])
844
	by dovector04.e.movistar.es with LMTP
845
	id uJGIMjsu9WKdGCwAw8zUEg
846
	(envelope-from <>)
847
	for <robin.listas@telefonica.net>; Thu, 11 Aug 2022 18:28:43 +0200
848
Received: from relayin04.e.movistar.es (217-116-1-119.redes.acens.net [217.116.1.119])
849
	by asavin02.e.movistar.es (Postfix) with ESMTP id 4M3XLM3wKWzCrwn
850
	for <robin.listas@telefonica.net>; Thu, 11 Aug 2022 18:28:43 +0200 (CEST)
851
X-Tnet-ASAV: Yes
852
Received: from EUR03-DBA-obe.outbound.protection.outlook.com (mail-dbaeur03olkn2101.outbound.protection.outlook.com [40.92.58.101])
853
	(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
854
	(No client certificate requested)
855
	by relayin04.e.movistar.es (Postfix) with ESMTPS id 4M3XLM2rNdzXdlD
856
	for <robin.listas@telefonica.net>; Thu, 11 Aug 2022 18:28:43 +0200 (CEST)
857
ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none;
858
 b=QRWd3H4cNMY2XbioIjjf2gLCCcaEoM13D+fblu+BREl8ehX8FnK7xDPh1bxu+3TEmGi23baudBD32az93uSWI6Yv9uZOHkMlW3zZ0Fk1vbVfyxCKmuPFG3BJOG9bDBKGkL9veNhiCq6ZVPDeo1AAc31otIhA//Hv++H4b9WwZAWwrBBYwu9crJlIg8zE7Fxwg84A9kipCTu7/jTXCiQNtiAA6Wa752z1n2wQF5AG0lIW261D61KJMKgW+O/Gza6GrcF9idd078C/ioaaZXlEFklj5mfROWL0/e2hNftyYo01Luw6YMVgnssIRFHBcBoWz6K/ZrNJ8u9VSMA7I1kiTQ==
859
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com;
860
 s=arcselector9901;
861
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1;
862
 bh=+VMSMraP5Nhn2J6bCvPoL2uJz06XtoDyWGIBDHdP67k=;
863
 b=MqSMjnbttGF7icat4usoW1uX/60VVzMJy+bnrIjS1mrRMjZ9ntSpXioq8MvRLZ/pKGRXzeB1kJ6soKSHZrOhYzfefUhnXY/F/K6SblHdORaz7X026CLiCuTRwkRkCcDR3UkCP1R9W+sD3+ASQa1FcFQzIHkLqgPVmWn1o1hD6Mcr8jj2LBW1wzb7LjqLpXOPYezmw1C8KFqk8kcLLF6nWFnL+eEI985iQRLTILJNBA0r9UJSN0iyxyZ45RCYeCg8+BEtEFAXI+tgR4870faAEQ8qoRg6YzkJtUatGXPaoHTTMiNHW/HascHQxez2s6VscKN41amJsjTuxMiFKISuyQ==
864
ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none;
865
 dkim=none; arc=none
866
MIME-Version: 1.0
867
From: <postmaster@outlook.com>
868
To: <robin.listas@telefonica.net>
869
Date: Thu, 11 Aug 2022 16:28:42 +0000
870
Content-Type: multipart/report; report-type=delivery-status;
871
	boundary="9301e56a-a151-491b-80e4-44a271448788"
872
X-MS-Exchange-Message-Is-Ndr:
873
Content-Language: en-CA
874
Message-ID:
875
 <82aa4446-08a4-4347-9422-2ff52b3dcea4@DU0P251MB0436.EURP251.PROD.OUTLOOK.COM>
876
In-Reply-To: <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
877
References: <ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net>
878
 <fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com>
879
 <95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net>
880
 <20220811112640.yothu2esdyy264nx@grusum.dhaller.de>
881
 <9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net>
882
 <20220811132813.GQ22216@wahoo.no-ip.org>
883
 <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
884
 <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
885
Subject: Undeliverable: Re: [oS-en] Recovering dead text file
886
Auto-Submitted: auto-replied
887
X-MS-PublicTrafficType: Email
888
X-MS-TrafficTypeDiagnostic: DU0P251MB0436:EE_
889
X-Microsoft-Antispam: BCL:0;
890
X-Microsoft-Antispam-Message-Info:
891
	ffZyO7xDbhxOKlKkGbYH9FPJW+tbiWDhDmO/ySQ0tn57zmwokTVdk85Z08H+9dW93jR7Ogk2K0X6HuG3VvLCJA56ae53E6LfL0L5Iv/xnWcK+G3sFOi+PU+IJJjhUNCKy1NSpaHQlL+rm/eeTsASoEP5PU0tovGJxRowPBFZGPh4ibQpOWYTOt+pDie1akh9U9GwvgB8aL5cABynGNsfb7SuaErOwjHDLAKoyJzWDfD4Atx20AyjM88eB37Zs3NiKCKZVhVPwotP7TjbSqhzfC20u2Q/cl7rsXLTs+HCBdwfMx4Uv+qEgHTtI1XDOhr2BX4S2pJ1+wTdkrbNA5VaJ8Vtxl75Cg/uNImAgqve4xDzSdj9Zqhqf3fD1e4wNujP0DOU6/pp3XOjIBkHI3YKdRt/zvalcSezf9lFStee8vRzXPAuZ9zVVnj2iDvNSTtJKeSyeyy61wUhbUnWEcyR8nsA8ACp/VnwK3FFBFO8gtlIKTnLgQhsB0tiMPRTaZe2q1k3Yiz9X/1mlDgIi8q4uw6xgqtBdEu4R9nC2abZnpc5hBP9ieWzbFlli3F2cqB+28beLeihRxHqPLWCTKGXF4/aR7x60dPmc0CV9scnzYZdj5TyoFge439bhXoH/SjtKaAGN8JlGRpg8nEPAOPFrWjn6CG0ibeveSxqdMJg89MrA6VVdPeAjOfs4faQpTbeXihIotXoVznp6bzu8/BXEZWHTV0AjlqC1P/M8qGCPgM=
892
X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1
893
X-MS-Exchange-AntiSpam-MessageData-0:
894
	IRPIlrTaEsGBKP90Wto9nuB2RLX84ecDD53QKc8lj91z+7otwWzDFmx6oLwGSEcBBQZKlSaCk8zaLNPhqqT9tczTCWQGSFdeslcf2OstmTCxOdKvCmJDISCLKUzmTNTZvdIXKt43ocvXCyq1QQ4P5fCaMXDt5L5wk0lN0SV7Q839Hp8Htnz5EnDrahdcsq+x
895
X-OriginatorOrg: outlook.com
896
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 11 Aug 2022 16:28:42.3912
897
 (UTC)
898
X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted
899
X-MS-Exchange-CrossTenant-AuthSource: DU0P251MB0436.EURP251.PROD.OUTLOOK.COM
900
X-MS-Exchange-CrossTenant-AuthAs: Internal
901
X-MS-Exchange-CrossTenant-Network-Message-Id:
902
	861c8731-3ca1-4c3d-4a83-08da7bb68e0e
903
X-MS-Exchange-Transport-CrossTenantHeadersStamped: DU0P251MB0436
904
X-TnetIn-SenderInfo: IP: 40.92.58.101 | Country: US | SPF: none
905
X-VADETIN-SPAMSTATE: bounce
906
X-VADETIN-SPAMSCORE: 10000
907
X-VADETIN-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrvdeggedguddtudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucetvefgpffuqdeuvdevnecuuegrihhlohhuthemuceftddtnecupfhothhifhhitggrthhiohhnucdluddttddttddmnecujfgurhepggfhvffftgfkjghfufesphdtreertddtvdenucfhrhhomhepoehpohhsthhmrghsthgvrhesohhuthhlohhokhdrtghomheqnecuggftrfgrthhtvghrnhepieeufefggfeuvdekgeffhedutdejjeegueeftdejteekueffuedthfegtdetfeegnecuffhomhgrihhnpegvuhhrphdvhedurdhprhhougdpghhoohhglhgvrdgtohhmpdhophgvnhhsuhhsvgdrohhrghdpohhuthhlohhokhdrtghomhdpvghophdqvghurhdthedrphhrohgunecukfhppeegtddrledvrdehkedruddtudenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeegtddrledvrdehkedruddtuddphhgvlhhopefgfgfttdefqdffueetqdhosggvrdhouhhtsghouhhnugdrphhrohhtvggtthhiohhnrdhouhhtlhhoohhkrdgtohhmpdhnsggprhgtphhtthhopedupdhrtghpthhtoheprhhosghinhdrlhhishhtrghssehtvghlvghfohhnihgtrgdrnhgvth
908
X-TnetIn-Information: AntiSPAM and AntiVIRUS on asavin02
909
X-TnetIn-MsgID: 4M3XLM3wKWzCrwn.A5EE9
910
X-TnetIn-SpamCheck: no es spam, bounce DKIM_NONE SPF_NONE
911
X-TnetIn-From: 
912
X-Spam-Status: No
913
Status: R
914
X-Status: 
915
X-Keywords: NonJunk          
916
X-UID: 3
917

    
918
--9301e56a-a151-491b-80e4-44a271448788
919
Content-Type: multipart/alternative; differences=Content-Type;
920
	boundary="715bad8e-304f-4fd2-8da8-fdc95d1dca3f"
921

    
922
--715bad8e-304f-4fd2-8da8-fdc95d1dca3f
923
Content-Type: text/plain; charset="us-ascii"
924
Content-Transfer-Encoding: quoted-printable
925

    
926
Delivery has failed to these recipients or groups:
927

    
928
amdlnx60@googlemail.com<mailto:amdlnx60@googlemail.com>
929
Your message wasn't delivered because the recipient's email provider reject=
930
ed it.
931

    
932

    
933

    
934

    
935

    
936

    
937

    
938

    
939
Diagnostic information for administrators:
940

    
941
Generating server: DU0P251MB0436.EURP251.PROD.OUTLOOK.COM
942

    
943
amdlnx60@googlemail.com
944
Remote Server returned '550-5.7.26 The MAIL FROM domain [telefonica.net] ha=
945
s an SPF record with a hard 550-5.7.26 fail policy (-all) but it fails to p=
946
ass SPF checks with the ip: 550-5.7.26 [104.47.1.58]. To best protect our u=
947
sers from spam and phishing, the 550-5.7.26 message has been blocked. Pleas=
948
e visit 550-5.7.26 https://support.google.com/mail/answer/81126#authenticat=
949
ion for more 550 5.7.26 information. d9-20020a17090648c900b0072b6290f476si6=
950
427028ejt.842 - gsmtp'
951

    
952
Original message headers:
953

    
954
Received: from DB9P251MB0545.EURP251.PROD.OUTLOOK.COM (2603:10a6:10:336::16=
955
)
956
 by DU0P251MB0436.EURP251.PROD.OUTLOOK.COM (2603:10a6:10:348::5) with
957
 Microsoft SMTP Server (version=3DTLS1_2,
958
 cipher=3DTLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.5504.22; Thu, 11 =
959
Aug
960
 2022 16:28:41 +0000
961
Resent-From: <ppapen@hotmail.de>
962
Received: from DB9P251MB0545.EURP251.PROD.OUTLOOK.COM ([::1]) by
963
 DB9P251MB0545.EURP251.PROD.OUTLOOK.COM ([fe80::e5a7:3809:4544:e331%9]) wit=
964
h
965
 Microsoft SMTP Server id 15.20.5504.022; Thu, 11 Aug 2022 16:28:41 +0000
966
Authentication-Results: spf=3Dpass (sender IP is 195.135.221.145)
967
 smtp.mailfrom=3Dlists.opensuse.org; dkim=3Dnone (message not signed)
968
 header.d=3Dnone;dmarc=3Dfail action=3Dnone header.from=3Dtelefonica.net;
969
Received-SPF: Pass (protection.outlook.com: domain of lists.opensuse.org
970
 designates 195.135.221.145 as permitted sender)
971
 receiver=3Dprotection.outlook.com; client-ip=3D195.135.221.145;
972
 helo=3Danna.opensuse.org; pr=3DC
973
X-IncomingTopHeaderMarker: OriginalChecksum:213345641CC7BC68E0CF1FCC4E72E5F=
974
2C282E1017109CDA66673745EDB23B8ED;UpperCasedChecksum:C7A126D800CD162BC22EDC=
975
CCC2C1272096174F0F5FB45A84A601957AA4421D44;SizeAsReceived:4948;Count:46
976
X-Spam-Checker-Version: SpamAssassin 3.4.5 (2021-03-20) on mx2
977
X-Spam-Level:
978
X-Spam-Status: No, score=3D0.1 required=3D5.0 tests=3DDMARC_NONE,FREEMAIL_F=
979
ROM,
980
        NICE_REPLY_A,SPF_HELO_NONE autolearn=3Ddisabled version=3D3.4.5
981
X-Spam-Virus: No
982
X-Virus-Scanned: amavisd-new at valinor
983
Message-ID: <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
984
Date: Thu, 11 Aug 2022 18:28:21 +0200
985
MIME-Version: 1.0
986
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:91.0) Gecko/20100101
987
 Thunderbird/91.12.0
988
Subject: Re: [oS-en] Recovering dead text file
989
Content-Language: en-CA
990
To: oS-EN <users@lists.opensuse.org>
991
References: <ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net>
992
 <fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com>
993
 <95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net>
994
 <20220811112640.yothu2esdyy264nx@grusum.dhaller.de>
995
 <9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net>
996
 <20220811132813.GQ22216@wahoo.no-ip.org>
997
 <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
998
From: "Carlos E. R." <robin.listas@telefonica.net>
999
In-Reply-To: <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
1000
Content-Type: multipart/signed; micalg=3Dpgp-sha256;
1001
 protocol=3D"application/pgp-signature";
1002
 boundary=3D"------------N3z4990QrR8wFqNb7EF9Cg0r"
1003
X-TnetOut-Country: IP: 79.150.123.19 | Country: ES
1004
X-TnetOut-Information: AntiSPAM and AntiVIRUS on relayout02
1005
X-TnetOut-MsgID: 4M3XKy0QlPzdbfk.A553F
1006
X-TnetOut-SpamCheck: no es spam (whitelisted), clean
1007
X-TnetOut-From: robin.listas@telefonica.net
1008
X-TnetOut-Watermark: 1660840102.1529@5uugFEPJkyEBjB7XwBJgLA
1009
Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
1010
X-Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
1011
X-MailFrom: SRS0=3DHh0y=3DYP=3Dtelefonica.net=3Drobin.listas@opensuse.org
1012
X-Mailman-Rule-Misses: dmarc-mitigation; no-senders; approved; emergency; l=
1013
oop; banned-address; member-moderation; header-match-config-1; header-match=
1014
-config-2; header-match-config-3; nonmember-moderation; administrivia; impl=
1015
icit-dest; max-recipients; max-size; news-moderation; no-subject; digests; =
1016
suspicious-header
1017
X-Mailman-Version: 3.3.5
1018
Precedence: list
1019
List-Id: openSUSE Users <users.lists.opensuse.org>
1020
Archived-At: <https://lists.opensuse.org/archives/list/users@lists.opensuse=
1021
.org/message/XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q/>
1022
List-Archive: <https://lists.opensuse.org/archives/list/users@lists.opensus=
1023
e.org/>
1024
List-Help: <mailto:users-request@lists.opensuse.org?subject=3Dhelp>
1025
List-Owner: <mailto:users-owner@lists.opensuse.org>
1026
List-Post: <mailto:users@lists.opensuse.org>
1027
List-Subscribe: <mailto:users-join@lists.opensuse.org>
1028
List-Unsubscribe: <mailto:users-leave@lists.opensuse.org>
1029
X-IncomingHeaderCount: 46
1030
Return-Path: robin.listas@telefonica.net
1031
X-EOPAttributedMessage: 0
1032
X-EOPTenantAttributedMessage: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa:0
1033
X-MS-PublicTrafficType: Email
1034
X-MS-UserLastLogonTime: 8/11/2022 4:16:05 PM
1035
X-MS-Office365-Filtering-Correlation-Id: b88e1e68-6510-4bcf-3a56-08da7bb68c=
1036
a5
1037
X-MS-TrafficTypeDiagnostic:
1038
        DU0P251MB0753:EE_|DB9P251MB0545:EE_|DU0P251MB0436:EE_
1039
X-MS-Exchange-EOPDirect: true
1040
X-Sender-IP: 195.135.221.145
1041
X-SID-PRA: ROBIN.LISTAS@TELEFONICA.NET
1042
X-SID-Result: NONE
1043
X-Microsoft-Antispam: BCL:1;
1044
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 11 Aug 2022 16:28:40.0093
1045
 (UTC)
1046
X-MS-Exchange-CrossTenant-Network-Message-Id: b88e1e68-6510-4bcf-3a56-08da7=
1047
bb68ca5
1048
X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa
1049
X-MS-Exchange-CrossTenant-AuthSource: AM6EUR05FT059.eop-eur05.prod.protecti=
1050
on.outlook.com
1051
X-MS-Exchange-CrossTenant-AuthAs: Anonymous
1052
X-MS-Exchange-CrossTenant-FromEntityHeader: Internet
1053
X-MS-Exchange-Transport-CrossTenantHeadersStamped: DU0P251MB0753
1054
X-MS-Exchange-Transport-EndToEndLatency: 00:00:01.2815003
1055
X-MS-Exchange-Processed-By-BccFoldering: 15.20.5504.022
1056
X-MS-Exchange-Inbox-Rules-Loop: ppapen@hotmail.de
1057
X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-00b75.templateTenant
1058

    
1059

    
1060
--715bad8e-304f-4fd2-8da8-fdc95d1dca3f
1061
Content-Type: text/html; charset="us-ascii"
1062
Content-Transfer-Encoding: quoted-printable
1063

    
1064
<html>
1065
<Head></head><body>
1066
<p><b><font color=3D"#000066" size=3D"3" face=3D"Arial">Delivery has failed=
1067
 to these recipients or groups:</font></b></p>
1068
<font color=3D"#000000" size=3D"2" face=3D"Tahoma"><p><a href=3D"mailto:amd=
1069
lnx60@googlemail.com">amdlnx60@googlemail.com</a><br>
1070
</font>
1071
<font color=3D"#000000" size=3D"3" face=3D"Arial">Your message wasn't deliv=
1072
ered because the recipient's email provider rejected it.<br>
1073
</font>
1074
<font color=3D"#000000" size=3D"2" face=3D"Tahoma"><br>
1075
</p>
1076
</font>
1077
<br><br><br><br><br><br>
1078
<font color=3D"#808080" size=3D"2" face=3D"Tahoma"><p><b>Diagnostic informa=
1079
tion for administrators:</b></p>
1080
<p>Generating server: DU0P251MB0436.EURP251.PROD.OUTLOOK.COM<br>
1081
</p>
1082
<p>amdlnx60@googlemail.com<br>
1083
Remote Server  returned '550-5.7.26 The MAIL FROM domain [telefonica.net] h=
1084
as an SPF record with a hard
1085
550-5.7.26 fail policy (-all) but it fails to pass SPF checks with the ip:
1086
550-5.7.26 [104.47.1.58]. To best protect our users from spam and phishing,=
1087
 the
1088
550-5.7.26 message has been blocked. Please visit
1089
550-5.7.26  https://support.google.com/mail/answer/81126#authentication for=
1090
 more
1091
550 5.7.26 information. d9-20020a17090648c900b0072b6290f476si6427028ejt.842=
1092
 - gsmtp'<br>
1093
</p>
1094
<p>Original message headers:</p>
1095
<pre>Received: from DB9P251MB0545.EURP251.PROD.OUTLOOK.COM (2603:10a6:10:33=
1096
6::16)
1097
 by DU0P251MB0436.EURP251.PROD.OUTLOOK.COM (2603:10a6:10:348::5) with
1098
 Microsoft SMTP Server (version=3DTLS1_2,
1099
 cipher=3DTLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.5504.22; Thu, 11 =
1100
Aug
1101
 2022 16:28:41 +0000
1102
Resent-From: &lt;ppapen@hotmail.de&gt;
1103
Received: from DB9P251MB0545.EURP251.PROD.OUTLOOK.COM ([::1]) by
1104
 DB9P251MB0545.EURP251.PROD.OUTLOOK.COM ([fe80::e5a7:3809:4544:e331%9]) wit=
1105
h
1106
 Microsoft SMTP Server id 15.20.5504.022; Thu, 11 Aug 2022 16:28:41 +0000
1107
Authentication-Results: spf=3Dpass (sender IP is 195.135.221.145)
1108
 smtp.mailfrom=3Dlists.opensuse.org; dkim=3Dnone (message not signed)
1109
 header.d=3Dnone;dmarc=3Dfail action=3Dnone header.from=3Dtelefonica.net;
1110
Received-SPF: Pass (protection.outlook.com: domain of lists.opensuse.org
1111
 designates 195.135.221.145 as permitted sender)
1112
 receiver=3Dprotection.outlook.com; client-ip=3D195.135.221.145;
1113
 helo=3Danna.opensuse.org; pr=3DC
1114
X-IncomingTopHeaderMarker: OriginalChecksum:213345641CC7BC68E0CF1FCC4E72E5F=
1115
2C282E1017109CDA66673745EDB23B8ED;UpperCasedChecksum:C7A126D800CD162BC22EDC=
1116
CCC2C1272096174F0F5FB45A84A601957AA4421D44;SizeAsReceived:4948;Count:46
1117
X-Spam-Checker-Version: SpamAssassin 3.4.5 (2021-03-20) on mx2
1118
X-Spam-Level:
1119
X-Spam-Status: No, score=3D0.1 required=3D5.0 tests=3DDMARC_NONE,FREEMAIL_F=
1120
ROM,
1121
	NICE_REPLY_A,SPF_HELO_NONE autolearn=3Ddisabled version=3D3.4.5
1122
X-Spam-Virus: No
1123
X-Virus-Scanned: amavisd-new at valinor
1124
Message-ID: &lt;1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net&gt;
1125
Date: Thu, 11 Aug 2022 18:28:21 +0200
1126
MIME-Version: 1.0
1127
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:91.0) Gecko/20100101
1128
 Thunderbird/91.12.0
1129
Subject: Re: [oS-en] Recovering dead text file
1130
Content-Language: en-CA
1131
To: oS-EN &lt;users@lists.opensuse.org&gt;
1132
References: &lt;ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net&gt;
1133
 &lt;fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com&gt;
1134
 &lt;95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net&gt;
1135
 &lt;20220811112640.yothu2esdyy264nx@grusum.dhaller.de&gt;
1136
 &lt;9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net&gt;
1137
 &lt;20220811132813.GQ22216@wahoo.no-ip.org&gt;
1138
 &lt;869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org&gt;
1139
From: &quot;Carlos E. R.&quot; &lt;robin.listas@telefonica.net&gt;
1140
In-Reply-To: &lt;869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org&gt;
1141
Content-Type: multipart/signed; micalg=3Dpgp-sha256;
1142
 protocol=3D&quot;application/pgp-signature&quot;;
1143
 boundary=3D&quot;------------N3z4990QrR8wFqNb7EF9Cg0r&quot;
1144
X-TnetOut-Country: IP: 79.150.123.19 | Country: ES
1145
X-TnetOut-Information: AntiSPAM and AntiVIRUS on relayout02
1146
X-TnetOut-MsgID: 4M3XKy0QlPzdbfk.A553F
1147
X-TnetOut-SpamCheck: no es spam (whitelisted), clean
1148
X-TnetOut-From: robin.listas@telefonica.net
1149
X-TnetOut-Watermark: 1660840102.1529@5uugFEPJkyEBjB7XwBJgLA
1150
Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
1151
X-Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
1152
X-MailFrom: SRS0=3DHh0y=3DYP=3Dtelefonica.net=3Drobin.listas@opensuse.org
1153
X-Mailman-Rule-Misses: dmarc-mitigation; no-senders; approved; emergency; l=
1154
oop; banned-address; member-moderation; header-match-config-1; header-match=
1155
-config-2; header-match-config-3; nonmember-moderation; administrivia; impl=
1156
icit-dest; max-recipients; max-size; news-moderation; no-subject; digests; =
1157
suspicious-header
1158
X-Mailman-Version: 3.3.5
1159
Precedence: list
1160
List-Id: openSUSE Users &lt;users.lists.opensuse.org&gt;
1161
Archived-At: &lt;https://lists.opensuse.org/archives/list/users@lists.opens=
1162
use.org/message/XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q/&gt;
1163
List-Archive: &lt;https://lists.opensuse.org/archives/list/users@lists.open=
1164
suse.org/&gt;
1165
List-Help: &lt;mailto:users-request@lists.opensuse.org?subject=3Dhelp&gt;
1166
List-Owner: &lt;mailto:users-owner@lists.opensuse.org&gt;
1167
List-Post: &lt;mailto:users@lists.opensuse.org&gt;
1168
List-Subscribe: &lt;mailto:users-join@lists.opensuse.org&gt;
1169
List-Unsubscribe: &lt;mailto:users-leave@lists.opensuse.org&gt;
1170
X-IncomingHeaderCount: 46
1171
Return-Path: robin.listas@telefonica.net
1172
X-EOPAttributedMessage: 0
1173
X-EOPTenantAttributedMessage: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa:0
1174
X-MS-PublicTrafficType: Email
1175
X-MS-UserLastLogonTime: 8/11/2022 4:16:05 PM
1176
X-MS-Office365-Filtering-Correlation-Id: b88e1e68-6510-4bcf-3a56-08da7bb68c=
1177
a5
1178
X-MS-TrafficTypeDiagnostic:
1179
	DU0P251MB0753:EE_|DB9P251MB0545:EE_|DU0P251MB0436:EE_
1180
X-MS-Exchange-EOPDirect: true
1181
X-Sender-IP: 195.135.221.145
1182
X-SID-PRA: ROBIN.LISTAS@TELEFONICA.NET
1183
X-SID-Result: NONE
1184
X-Microsoft-Antispam: BCL:1;
1185
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 11 Aug 2022 16:28:40.0093
1186
 (UTC)
1187
X-MS-Exchange-CrossTenant-Network-Message-Id: b88e1e68-6510-4bcf-3a56-08da7=
1188
bb68ca5
1189
X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa
1190
X-MS-Exchange-CrossTenant-AuthSource: AM6EUR05FT059.eop-eur05.prod.protecti=
1191
on.outlook.com
1192
X-MS-Exchange-CrossTenant-AuthAs: Anonymous
1193
X-MS-Exchange-CrossTenant-FromEntityHeader: Internet
1194
X-MS-Exchange-Transport-CrossTenantHeadersStamped: DU0P251MB0753
1195
X-MS-Exchange-Transport-EndToEndLatency: 00:00:01.2815003
1196
X-MS-Exchange-Processed-By-BccFoldering: 15.20.5504.022
1197
X-MS-Exchange-Inbox-Rules-Loop: ppapen@hotmail.de
1198
X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-00b75.templateTenant
1199
</pre>
1200
</font>
1201
</body>
1202
</html>=
1203

    
1204
--715bad8e-304f-4fd2-8da8-fdc95d1dca3f--
1205

    
1206
--9301e56a-a151-491b-80e4-44a271448788
1207
Content-Type: message/delivery-status
1208

    
1209
Reporting-MTA: dns;DU0P251MB0436.EURP251.PROD.OUTLOOK.COM
1210
Received-From-MTA: dns;DB9P251MB0545.EURP251.PROD.OUTLOOK.COM
1211
Arrival-Date: Thu, 11 Aug 2022 16:28:41 +0000
1212

    
1213
Final-Recipient: rfc822;amdlnx60@googlemail.com
1214
Action: failed
1215
Status: 5.7.26
1216
Diagnostic-Code: smtp;550-5.7.26 The MAIL FROM domain [telefonica.net] has an SPF record with a hard
1217
 550-5.7.26 fail policy (-all) but it fails to pass SPF checks with the ip:
1218
 550-5.7.26 [104.47.1.58]. To best protect our users from spam and phishing, the
1219
 550-5.7.26 message has been blocked. Please visit
1220
 550-5.7.26  https://support.google.com/mail/answer/81126#authentication for more
1221
 550 5.7.26 information. d9-20020a17090648c900b0072b6290f476si6427028ejt.842 - gsmtp
1222

    
1223

    
1224
--9301e56a-a151-491b-80e4-44a271448788
1225
Content-Type: message/rfc822
1226

    
1227
Received: from DB9P251MB0545.EURP251.PROD.OUTLOOK.COM (2603:10a6:10:336::16)
1228
 by DU0P251MB0436.EURP251.PROD.OUTLOOK.COM (2603:10a6:10:348::5) with
1229
 Microsoft SMTP Server (version=TLS1_2,
1230
 cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.5504.22; Thu, 11 Aug
1231
 2022 16:28:41 +0000
1232
Resent-From: <ppapen@hotmail.de>
1233
Received: from DB9P251MB0545.EURP251.PROD.OUTLOOK.COM ([::1]) by
1234
 DB9P251MB0545.EURP251.PROD.OUTLOOK.COM ([fe80::e5a7:3809:4544:e331%9]) with
1235
 Microsoft SMTP Server id 15.20.5504.022; Thu, 11 Aug 2022 16:28:41 +0000
1236
Authentication-Results: spf=pass (sender IP is 195.135.221.145)
1237
 smtp.mailfrom=lists.opensuse.org; dkim=none (message not signed)
1238
 header.d=none;dmarc=fail action=none header.from=telefonica.net;
1239
Received-SPF: Pass (protection.outlook.com: domain of lists.opensuse.org
1240
 designates 195.135.221.145 as permitted sender)
1241
 receiver=protection.outlook.com; client-ip=195.135.221.145;
1242
 helo=anna.opensuse.org; pr=C
1243
X-IncomingTopHeaderMarker: OriginalChecksum:213345641CC7BC68E0CF1FCC4E72E5F2C282E1017109CDA66673745EDB23B8ED;UpperCasedChecksum:C7A126D800CD162BC22EDCCCC2C1272096174F0F5FB45A84A601957AA4421D44;SizeAsReceived:4948;Count:46
1244
X-Spam-Checker-Version: SpamAssassin 3.4.5 (2021-03-20) on mx2
1245
X-Spam-Level:
1246
X-Spam-Status: No, score=0.1 required=5.0 tests=DMARC_NONE,FREEMAIL_FROM,
1247
	NICE_REPLY_A,SPF_HELO_NONE autolearn=disabled version=3.4.5
1248
X-Spam-Virus: No
1249
X-Virus-Scanned: amavisd-new at valinor
1250
Message-ID: <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
1251
Date: Thu, 11 Aug 2022 18:28:21 +0200
1252
MIME-Version: 1.0
1253
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:91.0) Gecko/20100101
1254
 Thunderbird/91.12.0
1255
Subject: Re: [oS-en] Recovering dead text file
1256
Content-Language: en-CA
1257
To: oS-EN <users@lists.opensuse.org>
1258
References: <ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net>
1259
 <fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com>
1260
 <95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net>
1261
 <20220811112640.yothu2esdyy264nx@grusum.dhaller.de>
1262
 <9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net>
1263
 <20220811132813.GQ22216@wahoo.no-ip.org>
1264
 <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
1265
From: "Carlos E. R." <robin.listas@telefonica.net>
1266
In-Reply-To: <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
1267
Content-Type: multipart/signed; micalg=pgp-sha256;
1268
 protocol="application/pgp-signature";
1269
 boundary="------------N3z4990QrR8wFqNb7EF9Cg0r"
1270
X-TnetOut-Country: IP: 79.150.123.19 | Country: ES
1271
X-TnetOut-Information: AntiSPAM and AntiVIRUS on relayout02
1272
X-TnetOut-MsgID: 4M3XKy0QlPzdbfk.A553F
1273
X-TnetOut-SpamCheck: no es spam (whitelisted), clean
1274
X-TnetOut-From: robin.listas@telefonica.net
1275
X-TnetOut-Watermark: 1660840102.1529@5uugFEPJkyEBjB7XwBJgLA
1276
Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
1277
X-Message-ID-Hash: XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q
1278
X-MailFrom: SRS0=Hh0y=YP=telefonica.net=robin.listas@opensuse.org
1279
X-Mailman-Rule-Misses: dmarc-mitigation; no-senders; approved; emergency; loop; banned-address; member-moderation; header-match-config-1; header-match-config-2; header-match-config-3; nonmember-moderation; administrivia; implicit-dest; max-recipients; max-size; news-moderation; no-subject; digests; suspicious-header
1280
X-Mailman-Version: 3.3.5
1281
Precedence: list
1282
List-Id: openSUSE Users <users.lists.opensuse.org>
1283
Archived-At: <https://lists.opensuse.org/archives/list/users@lists.opensuse.org/message/XBPCUBGTUVP3DUAVJWDOOFF6ZVDBZK6Q/>
1284
List-Archive: <https://lists.opensuse.org/archives/list/users@lists.opensuse.org/>
1285
List-Help: <mailto:users-request@lists.opensuse.org?subject=help>
1286
List-Owner: <mailto:users-owner@lists.opensuse.org>
1287
List-Post: <mailto:users@lists.opensuse.org>
1288
List-Subscribe: <mailto:users-join@lists.opensuse.org>
1289
List-Unsubscribe: <mailto:users-leave@lists.opensuse.org>
1290
X-IncomingHeaderCount: 46
1291
Return-Path: robin.listas@telefonica.net
1292
X-EOPAttributedMessage: 0
1293
X-EOPTenantAttributedMessage: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa:0
1294
X-MS-PublicTrafficType: Email
1295
X-MS-UserLastLogonTime: 8/11/2022 4:16:05 PM
1296
X-MS-Office365-Filtering-Correlation-Id: b88e1e68-6510-4bcf-3a56-08da7bb68ca5
1297
X-MS-TrafficTypeDiagnostic:
1298
 DU0P251MB0753:EE_|DB9P251MB0545:EE_|DU0P251MB0436:EE_
1299
X-MS-Exchange-EOPDirect: true
1300
X-Sender-IP: 195.135.221.145
1301
X-SID-PRA: ROBIN.LISTAS@TELEFONICA.NET
1302
X-SID-Result: NONE
1303
X-Microsoft-Antispam: BCL:1;
1304
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 11 Aug 2022 16:28:40.0093
1305
 (UTC)
1306
X-MS-Exchange-CrossTenant-Network-Message-Id: b88e1e68-6510-4bcf-3a56-08da7bb68ca5
1307
X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa
1308
X-MS-Exchange-CrossTenant-AuthSource: AM6EUR05FT059.eop-eur05.prod.protection.outlook.com
1309
X-MS-Exchange-CrossTenant-AuthAs: Anonymous
1310
X-MS-Exchange-CrossTenant-FromEntityHeader: Internet
1311
X-MS-Exchange-Transport-CrossTenantHeadersStamped: DU0P251MB0753
1312
X-MS-Exchange-Transport-EndToEndLatency: 00:00:01.2815003
1313
X-MS-Exchange-Processed-By-BccFoldering: 15.20.5504.022
1314
X-MS-Exchange-Inbox-Rules-Loop: ppapen@hotmail.de
1315
X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-00b75.templateTenant
1316

    
1317
--------------N3z4990QrR8wFqNb7EF9Cg0r
1318
Content-Type: multipart/mixed; boundary="------------nn2XDWNWL3yqreADLJ0weXbT";
1319
 protected-headers="v1"
1320
From: "Carlos E. R." <robin.listas@telefonica.net>
1321
To: oS-EN <users@lists.opensuse.org>
1322
Message-ID: <1f489760-24d5-2d3d-d1a2-9774c79d1973@telefonica.net>
1323
Subject: Re: [oS-en] Recovering dead text file
1324
References: <ed884162-3bf4-e460-b681-09b082a2b43d@telefonica.net>
1325
 <fccd63b9-1861-d86b-6cec-860da14e395b@suddenlinkmail.com>
1326
 <95334ac4-4c78-28a9-311a-cc203a7e2900@telefonica.net>
1327
 <20220811112640.yothu2esdyy264nx@grusum.dhaller.de>
1328
 <9b08171d-9ff2-3410-bb52-f4319b607984@telefonica.net>
1329
 <20220811132813.GQ22216@wahoo.no-ip.org>
1330
 <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
1331
In-Reply-To: <869e3a38-04e0-7840-f2ae-c771f84aab9a@dodin.org>
1332

    
1333
--------------nn2XDWNWL3yqreADLJ0weXbT
1334
Content-Type: text/plain; charset=UTF-8; format=flowed
1335
Content-Transfer-Encoding: base64
1336

    
1337
T24gMjAyMi0wOC0xMSAxNzo0NSwgamRkQGRvZGluLm9yZyB3cm90ZToNCj4gTGUgMTEvMDgv
1338
MjAyMiDDoCAxNToyOCwgUGF0cmljayBTaGFuYWhhbiBhIMOpY3JpdMKgOg0KPiANCj4+IEkg
1339
c2VlIHR3byBwYXRocywgcmVpbnN0YWxsIGpvZS4gYW5kL29yIHJlbW92ZSB+Ly5qb2VyYyBh
1340
bmQgcmVpbmFibGUgZWFjaA0KPj4gb3B0aW9uIG9uZSBvciBhIGZldyBhdCBhIHRpbWUgdW50
1341
aWwgeW91IGZpbmQgY3VscHJldC4NCj4+DQo+Pg0KPiBqdXN0IGZvciBpbmZvLiBJIHJlYWQg
1342
dGhpcyB0aHJlYWQsIGJ1dCBuZXZlciB1c2VkIGpvZSBwcmV2aW91c2x5IA0KPiAob3BlblNV
1343
U0UgMTUuMykNCj4gDQo+IGFmdGVyIGxhdW5jaGluZyBqb2UgKGp1c3QgImpvZSA8UkM+Iiks
1344
IHR5cGluZyBzb21lIHRleHQgYW5kIGNsb3NpbmcgdGhlIA0KPiB0ZXJtaW5hbCwgSSBoYXZl
1345
ICpubyogam9lIGZpbGUgYXQgYWxsIGJ1dCBhIC5qb2Vfc3RhdGUNCj4gDQo+IG5vIC5qb2Vy
1346
Yywgbm8gREVBRC4uLiB0aGluZw0KDQpJbnN0ZWFkIG9mIGNsb3NpbmcgdGhlIHRlcm1pbmFs
1347
LCB1c2UgImtpbGwge1BJRH0iIG9yICJraWxsYWxsIGpvZSINCg0KSSBqdXN0IGRpZCB0aGF0
1348
LCBubyBkZWFkIHRoaW5nLg0KDQpUaGVuIEkgbW92ZWQgdGhlICIuam9lX3N0YXRlIiBmaWxl
1349
IGFuZCB0cmllZCBhZ2FpbiwgYW5kIG9uIGtpbGwgSSBnb3Q6DQoNCioqKiBKT0Ugd2FzIGFi
1350
b3J0ZWQgYnkgVU5JWCBzaWduYWwgMTUuICBCdWZmZXJzIHNhdmVkIGluIERFQURKT0UNCg0K
1351
DQphbmQgc3VyZSBlbm91Z2gsIHRoZSBERUFESk9FIGZpbGUgd2FzIGluIHRoZSBjdXJyZW50
1352
IGRpcmVjdG9yeSBydW5uaW5nIA0KdGhlIGVkaXRvciBwcm9ncmFtLg0KDQoNCi0tIA0KQ2hl
1353
ZXJzIC8gU2FsdWRvcywNCg0KCQlDYXJsb3MgRS4gUi4NCgkJKGZyb20gMTUuMyB4ODZfNjQg
1354
YXQgVGVsY29udGFyKQ0K
1355

    
1356
--------------nn2XDWNWL3yqreADLJ0weXbT--
1357

    
1358
--------------N3z4990QrR8wFqNb7EF9Cg0r
1359
Content-Type: application/pgp-signature; name="OpenPGP_signature.asc"
1360
Content-Description: OpenPGP digital signature
1361
Content-Disposition: attachment; filename="OpenPGP_signature"
1362

    
1363
-----BEGIN PGP SIGNATURE-----
1364

    
1365
wmMEABEIACMWIQQZEb51mJKK1KpcU/W1MxgcbY1H1QUCYvUuJQUDAAAAAAAKCRC1MxgcbY1H1ZdF
1366
AJ4/wbqmjNtrmfWApfZiJ7J0s92s8wCeNme3Rf0xeJHSIIQ26ucLQ62TgaU=
1367
=jHRu
1368
-----END PGP SIGNATURE-----
1369

    
1370
--------------N3z4990QrR8wFqNb7EF9Cg0r--
1371

    
1372
--9301e56a-a151-491b-80e4-44a271448788--
1373